Modul GP KK-A TK/PAUD

PPPPTK TK DAN PLB BANDUNG
© 2016
i
Kode Mapel : 020KB000
PEDAGOGIK: Karakteristik Anak Usia Dini PROFESIONAL: Masalah dan Penanganan Anak Usia Dini
Penulis
1. Dra. Elis Supartini, M.Pd.;081321067602; sayaelis@yahoo.co.id
2. Dini Wati, S.Pd., M.Si.;085722392650;diniwati14@gmail.com
Penelaah
Dr. Putu Aditya A, S.Pd., M.Pd.; 087863031350;putu.aditya.antara@gmail.com Ilustrator
Eko Haryono, S.Pd.,M.Pd; 087824751905;haryono_eko76@yahoo.com Cetakan Pertama, 2015 Copyright @ 2016 Pusat Pengembangan dan Pemberdayaan Pendidik dan Tenaga Kependidikan Taman Kanak-Kanak dan Pendidikan Luar Biasa, Direktorat Guru dan Tenaga Kependidikan Hak Cipta Dilindungi Undang-Undang Dilarang mengcopy sebagian atau keseluruhan isi buku ini untuk kepentingan komersial tanpa izin tertulis dari Kementerian Pendidikan dan Kebudayaan
MODUL GURU PEMBELAJAR TAMAN KANAK-KANAK KELOMPOK KOMPETENSI A
PPPPTK TK DAN PLB BANDUNG
© 2016
ii
PPPPTK TK DAN PLB BANDUNG
© 2016
iii
016
KATA SAMBUTAN
Peran Guru Profesional dalam proses pembelajaran sangat penting sebagai kunci keberhasilan belajar siswa. Guru profesional adalah guru yang kompeten membangun proses pembelajaran yang baik sehingga dapat menghasilkan pendidikan yang berkualitas. Hal tersebut menjadikan guru sebagai komponen yang menjadi fokus perhatian pemerintah pusat maupun pemerintah daerah dalam peningkatan mutu pendidikan terutama menyangkut kompetensi guru. Pengembangan profesionalitas guru melalui program Guru Pembelajar merupakan upaya peningkatan kompetensi untuk semua guru. Sejalan dengan hal tersebut, pemetaan kompetensi guru telah dilakukan melalui uji kompetensi guru (UKG) untuk kompetensi pedagogik dan profesional pada akhir tahun 2015. Hasil UKG menunjukkan peta kekuatan dan kelemahan kompetensi guru dalam penguasaan pengetahuan. Peta kompetensi guru tersebut dikelompokkan menjadi 10 (sepuluh) kelompok kompetensi. Tindak lanjut pelaksanaan UKG diwujudkan dalam bentuk pelatihan guru paska UKG melalui program Guru Pembelajar. Tujuannya untuk meningkatkan kompetensi guru sebagai agen perubahan dan sumber belajar utama bagi peserta didik. Program Guru Pembelajar dilaksanakan melalui pola tatap muka, daring (online), dan campuran (blended) tatap muka dengan online. Pusat Pengembangan dan Pemberdayaan Pendidik dan Tenaga Kependidikan (PPPPTK), Lembaga Pengembangan dan Pemberdayaan Pendidik dan Tenaga Kependidikan Kelautan Perikanan Teknologi Informasi dan Komunikasi (LP3TK KPTK), dan Lembaga Pengembangan dan Pemberdayaan Kepala Sekolah (LP2KS) merupakan Unit Pelaksana Teknis di lingkungan Direktorat Jenderal Guru dan Tenaga Kependidikan yang bertanggung jawab dalam mengembangkan perangkat dan melaksanakan peningkatan kompetensi guru sesuai bidangnya. Adapun perangkat pembelajaran yang dikembangkan tersebut adalah modul untuk program Guru Pembelajar tatap muka dan Guru Pembelajar daring untuk semua mata pelajaran dan kelompok kompetensi. Dengan modul ini diharapkan program Guru Pembelajar memberikan sumbangan yang sangat besar dalam peningkatan kualitas kompetensi guru. Mari kita sukseskan program Guru Pembelajar ini untuk mewujudkan Guru Mulia Karena Karya.
PPPPTK TK DAN PLB BANDUNG
© 2016
iv
PPPPTK TK DAN PLB BANDUNG
© 2016
v
KATA PENGANTAR Kebijakan Kementerian Pendidikan dan Kebudayaan dalam meningkatkan kompetensi guru secara berkelanjutan, diawali dengan pelaksanaan Uji Kompetensi Guru dan ditindaklanjuti dengan Program Guru Pembelajar. Untuk memenuhi kebutuhan bahan ajar kegiatan tersebut, Pusat Pengembangan dan Pemberdayaan Pendidik dan Tenaga Kependidikan Taman Kanak-Kanak dan Pendidikan Luar Biasa (PPPPTK TK dan PLB), telah mengembangkan Modul Guru Pembelajar Bidang Taman Kanak-kanak yang merujuk pada Peraturan Menteri Pendidikan dan Kebudayaan Nomor 137 Tahun 2014 tentang Standar Pendidikan Anak Usia Dini. Kedalaman materi dan pemetaan kompetensi dalam modul ini disusun menjadi sepuluh kelompok kompetensi. Setiap modul meliputi pengembangan materi kompetensi pedagogik dan profesional bagi guru Taman Kanak-kanak. Judul-judul modul yang disusun sebagai berikut; (1) Karakteristik Anak Usia Dini, (2) Teori Bermain dan Merancang Kegiatan Bermain di Taman Kanak-kanak, (3) Kurikulum dan Program Pembelajaran di Taman Kanak-kanak, (4) Penyelenggaraan Kegiatan Pengembangan yang Mendidik, (5) Pemanfaatan Teknologi Informasi dan Komunikasi di Taman Kanak-kanak, (6) Media dan Sumber Belajar di Taman Kanak-kanak, (7) Komunikasi Efektif bagi Guru Taman Kanak-kanak, (8) Konsep dan Teknik Penilaian di Taman Kanak-kanak, (9) Penelitian Tindakan Kelas dan Pemanfaatan PTK dalam Pengembangan Anak di Taman Kanak-kanak, (10) Layanan Bantuan Peserta Didik dan Pengembangan Profesi Guru.
Kami berharap modul yang disusun ini dapat menjadi bahan rujukan utama dalam pelaksanaan Program Guru Pembelajar Bidang Taman Kanak-kanak. Untuk pengayaan materi, peserta disarankan untuk menggunakan referensi lain yang relevan. Kami mengucapkan terima kasih kepada semua pihak yang telah berperan aktif dalam penyusunan modul ini.
Bandung, Februari 2016 Kepala, Drs. Sam Yhon, M.M. NIP. 195812061980031003
PPPPTK TK DAN PLB BANDUNG
© 2016
vi
PPPPTK TK DAN PLB BANDUNG
© 2016
vii
DAFTARISI
KATA SAMBUTAN .......................................................................................................... iii
KATA PENGANTAR .............................................................. Error! Bookmark not defined.
DAFTAR ISI .................................................................................................................... vii
DAFTAR TABEL ............................................................................................................. ix
DAFTAR GAMBAR .......................................................................................................... x
PENDAHULUAN .............................................................................................................. 1
A. Latar Belakang ....................................................................................................... 1
B. Tujuan .................................................................................................................... 2
C. Peta Kompetensi.................................................................................................... 3
D. Ruang Lingkup ....................................................................................................... 3
E. Saran Cara Penggunaan Modul ............................................................................. 4
KOMPETENSI PEDAGOGIK: KARAKTERISTIK ANAK USIA DINI ................................ 5
KEGIATAN PEMBELAJARAN 1 ...................................................................................... 7
KARAKTERISTIK PERKEMBANGAN ANAK USIA DINI ................................................. 7
A. Tujuan .................................................................................................................... 7
B. Indikator Pencapaian Kompetensi .......................................................................... 7
C. Uraian Materi ......................................................................................................... 7
D. Aktivitas Pembelajaran......................................................................................... 38
E. Latihan/Kasus/Tugas ........................................................................................... 40
F. Rangkuman ......................................................................................................... 41
G. Umpan Balik dan Tindak Lanjut ........................................................................... 42
KEGIATAN PEMBELAJARAN 2 TUGAS PERKEMBANGAN ANAK TK ................................................................................................................................... 43
A. Tujuan .................................................................................................................. 43
B. Indikator Pencapaian Kompetensi ........................................................................ 43
C. Uraian Materi ....................................................................................................... 43
D. Aktivitas Pembelajaran......................................................................................... 66
E. Latihan/Kasus/Tugas ........................................................................................... 67
F. Rangkuman ......................................................................................................... 69
G. Umpan Balik dan Tindak Lanjut ........................................................................... 70
PPPPTK TK DAN PLB BANDUNG
© 2016
viii
KOMPETENSI PROFESIONAL: MASALAH DAN PENANGANAN ANAK USIA DINI ............................................................................................................ 71
KEGIATAN PEMBELAJARAN 3 .................................................................................... 73
DETEKSI DINI TUMBUH KEMBANG ANAK USIA DINI ................................................ 73
A. Tujuan .................................................................................................................. 73
B. Indikator Pencapaian Kompetensi ........................................................................ 73
C. Uraian Materi ....................................................................................................... 73
D. Aktivitas Pembelajaran....................................................................................... 101
E. Latihan/Kasus/Tugas ......................................................................................... 102
F. Rangkuman ....................................................................................................... 105
G . Umpan Balik dan Tindak Lanjut ............................................................................... 107
KEGIATAN PEMBELAJARAN 4 .................................................................................. 110
PERMASALAHAN PERKEMBANGAN ANAK USIA DINI DAN PENANGANANNYA ..................................................................................................... 110
A. Tujuan ................................................................................................................ 110
B. Indikator Pencapaian Kompetensi ...................................................................... 110
C. Uraian Materi ..................................................................................................... 110
D. Aktivitas Pembelajaran....................................................................................... 143
E. Latihan/Kasus/Tugas ......................................................................................... 145
F. Rangkuman ....................................................................................................... 147
G. Umpan Balik dan Tindak Lanjut ......................................................................... 148
KUNCI JAWABAN ........................................................................................................ 151
EVALUASI .................................................................................................................... 152
PENUTUP ..................................................................................................................... 157
DAFTAR PUSTAKA ..................................................................................................... 158
GLOSARIUM ................................................................................................................ 161
PPPPTK TK DAN PLB BANDUNG
© 2016
ix
DAFTAR TABEL
Tabel 1 1. Tahap Perkembangan Sosial Erikson ..................................... 20
Tabel 2 1. Fase-fase Perkembangan Individu .......................................... 49
Tabel 3 1. Pelaksanaan dan Alat yang Digunakan Untuk Deteksi Dini Penyimpangan Pertumbuhan ................................................................... 77
Tabel 3 2. Pelaksana dan Alat yang digunakan Untuk Deteksi Dini Penyimpangan Perkembangan Anak ....................................................... 79
PPPPTK TK DAN PLB BANDUNG
© 2016
x
DAFTAR GAMBAR
Gambar 3. 1 Tes Daya Lihat ................................................................... 93
PPPPTK TK DAN PLB BANDUNG
© 2016
1
PENDAHULUAN
A. Latar Belakang
Anak yang sehat, cerdas, berpenampilan menarik, dan berakhlak mulia merupakan dambaan setiap orang tua. Agar dapat mencapai hal tersebut terdapat berbagai kriteria yang harus terpenuhi dalam pertumbuhan dan perkembangan anak, salah satunya adalah faktor keturunan atau genetika. Namun, selain faktor keturunan masih terdapat faktor lain yang mempengaruhi kualitas seorang anak. Kualitas seorang anak dapat dinilai dari proses tumbuh kembang. Proses tumbuh kembang merupakan hasil interaksi faktor genetik dan faktor lingkungan. Faktor genetik/keturunan adalah faktor yang berhubungan dengan gen yang berasal dari ayah dan ibu, sedangkan faktor lingkungan meliputi lingkungan biologis, fisik, psikologis, dan sosial. Pertumbuhan dan perkembangan mengalami peningkatan yang pesat pada usia dini, yaitu dari 0 sampai 5 tahun. Masa ini sering juga disebut sebagai fase ”Golden Age”. Golden age merupakan masa yang sangat penting untuk memperhatikan tumbuh kembang anak secara cermat agar sedini mungkin dapat terdeteksi apabila terjadi kelainan. Selain itu, penanganan kelainan yang sesuai pada masa golden age dapat meminimalisir kelainan pertumbuhan dan perkembangan anak sehingga kelainan yang bersifat permanen dapat dicegah. Deteksi tumbuh kembang anak meliputi deteksi dari aspek fisik, psikologi, dan sosial. Deteksi tersebut harus dilakukan secara teratur dan berkesinambungan. Sedini mungkin deteksi dapat dilakukan oleh guru maupun orang tua. Selain itu deteksi tumbuh kembang anak juga dapat dilakukan oleh masyarakat melalui kegiatan posyandu dan oleh guru di sekolah. Oleh karena itu, pengetahuan tentang deteksi dini pertumbuhan
PPPPTK TK DAN PLB BANDUNG
© 2016
2
dan perkembangan anak perlu dimiliki oleh orang tua, guru, dan masyarakat. Modul dengan topik Karakteristik Tumbuh Kembang Anak Taman Kanak-kanak ini merupakan modul level 1 dari 10 level modul yang disajikan pada Diklat Guru Pembelajar bagi Guru TK Pasca UKG. Secara lengkap ke 10 level modul yang dimaksud adalah :
1. Deteksi Tumbuh Kembang Anak Usia Dini
2. Teori Bermain dan Perkembangan Anak TK
3. Kurikulum dan Pembelajaran di TK
4. Strategi Pengembangan dan Pembelajaran Anak TK
5. Teknologi Informasi dalam Pembelajaran di TK
6. Media Pembelajaran di TK
7. Komunikasi yang Efektif bagi Guru TK
8. Penilaian di TK
9. Penelitian Tindakan Kelas (PTK)
10. Penilaian Kinerja dan Pengembangan Keprofesian Berkelanjutan bagi Guru TK
Modul ini terdiri atas materi pokok, yaitu konsep dasar pertumbuhan dan perkembangan, tugas perkembangan anak TK, Deteksi dini tumbuh kembang anak TK, permasalahan dan gangguan anak TK dalam bidang pengembangan serta intervensinya. Pembahasan secara lebih spesifik akan disajikan pada setiap materi pokok dalam modul ini. Untuk masing-masing materi pokok, akan disajikan latihan, rangkuman, serta evaluasi dan tindak lanjutnya.
B. Tujuan
Secara umum tujuan yang diharapkan dicapai pada diklat kelompok kompetensi A ini adalah peserta mampu mengorganisasikan aspek perkembangan sesuai dengan karakteristik anak usia dini serta melakukan deteksi dan intervensi terhadap gangguan dan permasalahan anak usia dini dalam berbagai bidang pengembangan. Secara lebih spesifik tujuan yang diharapkan dapat dicapai pada mata diklat ini adalah:
PPPPTK TK DAN PLB BANDUNG
© 2016
3
Memahami konsep pertumbuhan dan perkembangan anak usia dini
1. Memahami karakteristik perkembangan anak usia dini
2. Memahami tugas perkembangan anak usia dini
3. Melakukan deteksi dini kemampuan anak usia dini
4. Melakukan deteksi terhadap permasalahan anak usia dini
5. Melakukan intervensi terhadap permasalahan anak usia dini
C. Peta Kompetensi
Diklat guru pembelajar Guru TK kelompok kompetensi A KarakteristikAnak usia dini dilaksanakan agar guru TK mampu menelaah dan mengelompokkan anak usia dini sesuai dengan karakteristik anak serta mengidentifikasi, melakukan deteksi terhadap kemampuan awal anak dan melakukan deteksi terhadap permasalahan anak Usia dini dalam berbagai bidang pengembangan.
D. Ruang Lingkup
Ruang lingkup modul terdiri atas:
1. Konsep pertumbuhan dan perkembangan anak usia dini, yang mencakup:
a. Pengertian perkembangan dan pertumbuhan anak
b. Karakteristik perkembangan anak
2. Tugas Perkembangan anak usia dini, yang mencakup:
a. Tugas perkembangan anak dalam bidang agama dan moral
b. Tugas perkembangan anak dalam bidang fisik motorik
c. Tugas perkembangan anak dalam bidang kognitif
d. Tugas perkembangan anak dalam bidang bahasa
e. Tugas perkembangan anak dalam bidang sosial emosional
f. Tugas perkembangan anak dalam bidang seni
3. Deteksi Dini Tumbuh Kembang anak usia dini, yang mencakup :
a. Hakekat Deteksi tumbuh kembang anak usia dini
b. Teknik dan alat deteksi dini tumbuh kembang anak usia dini
c. Strategi pelaksanaan deteksi tumbuh kembang anak usia dini
PPPPTK TK DAN PLB BANDUNG
© 2016
4
4. Permasalahan anak usia dini dalam berbagai bidang pengembangan, yang mencakup: a. Gangguan perkembangan anak dalam bidang fisik motorik b. Gangguan perkembangan anak dalam bidang bahasa c. Gangguan perkembangan anak dalam bidang sosial dan psikis (emosi) d. Gangguan kesulitan belajar anak
E. Saran Cara Penggunaan Modul
Untuk mengoptimalkan pemanfaatan modul ini sebagai bahan pelatihan, beberapa langkah berikut ini perlu menjadi perhatian para peserta pelatihan.
1. Lakukan pengecekan terhadap kelengkapan modul ini, seperti kelengkapan halaman, kejelasan hasil cetakan, serta kondisi modul secara keseluruhan.
2. Bacalah petunjuk penggunaan modul serta bagian Pendahuluan sebelum masuk pada pembahasan materi pokok.
3. Pelajarilah modul ini secara bertahap dimulai dari materi pokok I sampai tuntas, termasuk didalamnya latihan dan evaluasi sebelum melangkah ke materi pokok berikutnya.
4. Buatlah catatan-catatan kecil jika ditemukan hal-hal yang perlu pengkajian lebih lanjut atau disampaikan dalam sesi tatap muka.
5. Lakukanlah berbagai latihan sesuai dengan petunjuk yang disajikan pada masing-masing materi pokok. Demikian pula dengan kegiatan evaluasi dan tindak lanjutnya.
6. Disarankan tidak melihat kunci jawaban terlebih dahulu agar evaluasi yang dilakukan dapat mengukur tingkat penguasaan peserta terhadap materi yang disajikan.
7. Pelajarilah keseluruhan materi modul ini secara intensif. Modul ini dirancang sebagai bahan belajar mandiri persiapan uji kompetensi.
Selamat Mempelajari Isi Modul!
PPPPTK TK DAN PLB BANDUNG
© 2016
5
KOMPETENSI PEDAGOGIK:
KARAKTERISTIK
ANAK USIA DINI
PPPPTK TK DAN PLB BANDUNG
© 2016
6
PPPPTK TK DAN PLB BANDUNG
© 2016
7
KP
1
KEGIATAN PEMBELAJARAN 1
KARAKTERISTIK PERKEMBANGAN ANAK USIA DINI
A. Tujuan
Tujuan pembelajaran pada kegiatan pembelajaran 1 ini adalah agar peserta diklat mampu mengorganisasikan lingkup perkembangan sesuai dengan karakteristik anak usia dini.
B. Indikator Pencapaian Kompetensi
Setelah mengikuti seluruh kegiatan pembelajaran 1 ini kompetensi atau kinerja yang harus dikuasai adalah peserta mampu menelaah 6 lingkup perkembangan sesuai dengan karakteristik anak usia dini.
C. Uraian Materi
1. Definisi Perkembangan dan Pertumbuhan Pertumbuhan dapat diartikan sebagai perubahan yang bersifat kuantitatif, sebagai akibat dari adanya pengaruh luar atau lingkungan. Pertumbuhan mengandung arti adanya perubahan alam ukuran dan struktur tubuh sehingga lebih banyak menyangkut perubahan fisik. Selain dari pengertian di atas, pertumbuhan dapat didefinisikan pula sebagai perubahan secara fisiologis sebagai hasil dari proses pematangan fungsi-fungsi fisik yang berlangsung secara normal pada diri individu yang sehat dalam fase-fase tertentu. Hasil dari pertumbuhan ini berupa bertambah panjang tulang-tulang terutama lengan dan tungkai, bertambah tinggi dan berat badan serta makin bertambah sempurnanya susunan tulang dan jaringan syaraf. Pertumbuhan ini akan terhenti setelah adanya maturasi atau kematangan pada diri individu. Berbeda dengan pertumbuhan, perkembangan adalah suatu perubahan fungsional yang bersifat kualitatif, baik dari fungsi-fungsi fisik maupun mental sebagai hasil keterkaitannya dengan pengaruh
PPPPTK TK DAN PLB BANDUNG
© 2016
8
KP
1
lingkungan.Perkembangan dapat juga dikatakan sebagai suatu urutan-urutan perubahan yang bersifat sistematis, dalam arti saling kebergantungan atau saling mempengaruhi antara lingkup-lingkup fisik dan psikis dan merupakan satu kesatuan yang harmonis. Contoh, anak diperkenalkan bagaimana cara memegang pensil, membuat huruf-huruf dan diberi latihan oleh orang tuanya. Kemampuan belajar menulis akan mudah dan cepat dikuasai anak apabila proses latihan diberikan pada saat otot-ototnya telah tumbuh dengan sempurna, dan saat untuk memahami bentuk huruf telah diperoleh. Dengan demikian anak akan mampu memegang pensil dan membaca bentuk huruf. Selain itu perubahan juga bersifat progresif, yang berarti bahwa perubahan yang terjadi bersifat maju, meningkat dan mendalam baik secara kualitatif maupun kuantitatif. Contoh, perubahan pengetahuan dan kemampuan anak dari yang bersifat sederhana berkembang ke arah yang lebih kompleks. Berkesinambungan merupakan ciri lain dari perubahan yang terjadi, artinya perubahan itu berlangsung secara beraturan atau berurutan, tidak bersifat meloncat-loncat atau karena unsur kebetulan. Contoh, agar anak mampu berlari maka sebelumnya anak harus mampu berdiri dan merangkak terlebih dahulu. Melalui belajar anak akan berkembang, dan akan mampu mempelajari hal-hal yang baru. Perkembangan akan dicapai karena adanya proses belajar, sehingga anak memperoleh pengalaman baru dan menimbulkan perilaku baru. Dari uraian di atas kita bisa mengetahui bahwa pertumbuhan dan perkembangan anak memiliki pengertian yang berbeda tetapi memiliki kesinambungan makna dalam membangun karakter dan pendidikan anak usia dini (PAUD).
2. Prinsip-prinsip Pertumbuhan dan Perkembangan
Untuk memberikan pemahaman terhadap perkembangan anak, seorang guru perlu memahami prinsip-prinsip perkembangan anak itu sendiri.Melalui langkah ini, penafsiran guru, orang tua, serta pihak-pihak
PPPPTK TK DAN PLB BANDUNG
© 2016
9
KP
1
yang terkait dengan tumbuhkembang anak dapat diberikan secara proporsional dan tidak salah kaprah. Setidaknya, ketika guru, orang tua, dan atau pihak-pihak yang terkait dengan tumbuhkembang anak melihat ada perbedaan antara anak yang satu dengan anak yang lain dalam rentang usia yang sama, maka hal tersebut tidak serta merta menimbulkan persoalan. Berikut ini disajikan sejumlah prinsip-prinsip perkembangan anak, yaitu:
a. Perkembangan berlangsung secara kontinyu dan tidak terputus
Prinsip ini menunjukkan bahwa sepanjang manusia hidup maka sepanjang masa itulah perkembangan akan terus terjadi. Perkembangan dimulai ketika masa konsepsi sampai akhir hayatnya, yang ditandai oleh adanya perubahan pada diri individu, baik perubahan dalam ukuran maupun perubahan dalam fungsi.
b. Perkembangan berlangsung dalam urutan yang terpola
Perkembangan individu terjadi secara teratur mengikuti atau pola tertentu. Setiap perkembangan individu, sesungguhnya merupakan hasil perkembangan yang dicapai pada tahap-tahap sebelumnya dan merupakan bagian yang terintegrasi dengan lingkup-lingkup perkembangan anak itu sendiri. Sebagai contoh, kemampuan anak berjalan, tidak dapat dilepaskan dari pencapaian kemampuan anak berdiri yang sudah dicapai sebelumnya, dan kemampuan inidipengaruhi oleh semakin kuatnya otot-otot kaki yang terjadi pada anak. Dalam konteks yang lebih luas, Yelon dan Weinsten (Syamsu, 2006:17-18) mengemukakan arah atau pola perkembangan sebagai berikut:
1) Cephalocaudal & proximal-distal, yaitu perkembangan manusia yang dimulai dari kepala ke kaki (Cephalocaudal), jantung dan sebagainya, ke pinggir, tangan (proximal-distal).
2) Struktur mendahului fungsi. Hal ini berarti bahwa anggota tubuh individu akan dapat berfungsi setelah matang strukturnya. Seperti mata, akan dapat melihat setelah otot-ototnya matang atau kaki dapat difungsikan untuk berjalan setelah otot-ototnya matang.
PPPPTK TK DAN PLB BANDUNG
© 2016
10
KP
1
3) Perkembangan itu berdiferensiasi. Artinya perkembangan tersebut berlangsung dari umum ke khusus. Kondisi seperti ini terjadi dalam semua lingkup perkembangan baik fisik maupun psikis, seperti bayi menendang-nendang kakinya secara sembarangan sebelum fokus pada benda, arah, dan ukuran tertentu.
4) Perkembangan berlangsung dari kongkret ke abstrak. Artinya perkembangan tersebut berproses dari suatu kemampuan berpikir yang kongkret dengan objek yang tampak jelas ke arah yang lebih abstrak, seperti anak berhitung dengan bantuan jari tangannya sementara pada masa selanjutnya tidak memerlukan bantuan seperti itu.
5) Perkembangan itu berlangsung dari egosentrisme ke perspektivisme.Artinya seorang anak yang pada awalnya fokus pada diri sendiri secara berangsur melihat lingkungan sebagai bagian dari faktor yang dapat memenuhi kebutuhannya.
Perkembangan itu berlangsung dari “outter control to inner control.” Artinya anak yang pada awalnya berada dalam kontrol lingkungan, seperti ketergantungan pada orang tua dan kontrol lingkungan menuju ke arah kemandirian yang memungkinkan anak melakukan kontrol terhadap dirinya sendiri.
c. Irama dan tempo perkembangan bersifat individual
Sekalipun perkembangan memiliki arah dan pola tertentu, akan tetapi irama dan tempo perkembangan sesungguhnya bersifat unik. Artinya sekalipun seorang anak berada dalam rentang usia yang sama, akan tetapi tahapan pencapaian tugas-tugas perkembangan sangat mungkin berbeda. Sebagai contoh, anak-anak tertentu ada yang memiliki kemampuan berjalan pada usia 9 bulan, sementara yang lain baru dapat berjalan pada usia 12 atau 13 bulan. Demikian pula dengan kemampuan anak menggenggam, melempar, dan perkembangan lainnya.
d. Perkembangan bergerak dari yang umum ke yang khusus
Anak-anak cenderung akan memperhatikan benda-benda dalam pandangan global, utuh, dan nyata sebelum memperhatikan hal-hal yang lebih spesifik atau ditail. Sebagai contoh, ketika anak
PPPPTK TK DAN PLB BANDUNG
© 2016
11
KP
1
memperhatikan berbagai jenis mainan, maka anak cenderung akan memperhatikan mainan tersebut secara utuh. Seiring dengan bertambahnya usia dan berfungsinya kemampuan penglihatan anak, maka keinginan anak untuk memperhatikan ditail dari mainan tersebut juga akan berkembang.
e. Hasil proses belajar tergantung pada tingkat kematangan yang dicapai
Perkembangan yang dicapai anak sangat tergantung pada tingkat kematangan yang dicapai anak itu sendiri. Seorang anak yang belum mencapai kematangan untuk berdiri, akan sangat sulit jika diminta melakukan aktifitas berjalan atau bahkan berlari. Demikian pula dengan kemampuan melempar, yang akan sulit dapat dilakukan jika kemampuan anak menggenggam belum dikuasai dengan baik.
f. Faktor-faktor hereditas dan lingkungan memiliki pengaruh yang sama kuat terhadap proses perkembangan.
Sekalipun ada yang berpandangan bahwa faktor lingkungan lebih berpengaruh terhadap pertumbuhan dan perkembangan anak, akan tetapi sejatinya kedua faktor tersebut memiliki pengaruh yang sama. Sulit bagi anak untuk tidak mewarisi sifat-sifat kedua orang tuanya, termasuk dalam lingkup kogntif.
g. Perkembangan dapat mengalami kemunduran dan dapat pula dipercepat dalam batas-batas tertentu.
Melalui berbagai stimulasi dan keadaan yang dialami anak, maka sangat mungkin terjadi adanya kemunduran dan percepatan dalam perkembangan anak, sekalipun tidak terjadi secara ekstrim.Anak-anak yang memiliki asupan gizi yang rendah, sangat mungkin mengalami perlambatan dalam pencapaian pertumbuhan dan perkembangannya.Gizi yang rendah, memungkinkan memperlambat tumbuhnya otot-otot kaki yang membuatnya lambat memiliki kemampuan berjalan.Sementara itu, anak-anak yang memiliki stimulasi gizi atau lingkungan yang baik, dimungkinkan pula untuk memperoleh kemampuan berjalan, bersosialisasi, memperhatikan detail yang relatif lebih cepat dari perkembangan rata-rata anak lainnya.
PPPPTK TK DAN PLB BANDUNG
© 2016
12
KP
1
h. Pada usia tertentu terdapat perbedaan perkembangan/pertumbuhan antara anak laki-laki dengan anak perempuan.
Pengaruh hormonal pada anak laki-laki dan perempuan memiliki pengaruh dalam pertumbuhan dan perkembangannya. Anak perempuan cenderung mengalami pelambatan pertumbuhan tinggi badan ketika memasuki usia 15-17 tahun, sementara anak laki-laki masih mengalaminya sampai rata-rata usia 21 tahun. Anak perempuan cenderung terlihat lebih dewasa pada rentang usia yang sama dengan laki-laki, sekalipun pada usia-usia selanjutnya relatif lebih sejajar.
i. Bagian sifat-sifat individu dalam perkembangannya saling berkorelasi secara positif.
Sesuai dengan istilahnya, individu yang berasal dari kata un-devided yang bermakna tidak dapat dipisahkan, maka dalam perkembangannya, sifat-sifat yang dimiliki iindividu saling berkorelasi secara positif, baik sifat yang herediter maupun terbentuk dari lingkungan.
j. Setiap individu yang normal akan melewati segenap fase perkembangan.
Individu yang normal akan melewati segenap fase dengan seluruh ciri khasnya, seperti fase bayi, kanak-kanak, remaja, dewasa, dan masa tua.
3. Faktor-faktor yang Mempengaruhi Pertumbuhan danPerkembangan
Pertumbuhan dan perkembangan individu dipengaruhi oleh berbagai faktor yang dapat dikelompokkan pada faktor yang bersifat internal dan eksternal, atau dalam istilah Santrock (2007:19) menyebutnya dengan faktor nature dan nurture. Naturemerujuk pada warisan biologis seseorang, sedangkan nurture pada pengalaman lingkungannya. Faktor Internal
1) Faktor Hereditas
Hereditas merupakan faktor pertama yang mempengaruhi individu yang diturunkan oleh orang tua anak. Syamsu Yusuf (2006:34) menguraikan bahwa yang diturunkan oleh orang tua pada anak-
PPPPTK TK DAN PLB BANDUNG
© 2016
13
KP
1
anaknya adalah sifat strukturnya dan bukan tingkah laku yang diperoleh sebagai hasil belajar atau pengalaman. Penurunan sifat-sifat ini mengikuti prinsip-prinsip sebagai berikut:
a) Reproduksi yang berarti penurunan sifat-sifatnya hanya berlangsung melalui sel benih.
b) Konformitas (keseragaman) dimana proses penurunan sifat akan mengikuti pola jenis (species) generasi sebelumnya, misalnya manusia akan menurunkan sifat-sifat manusia kepada anaknya
c) Variasi, karena jumlah gen-gen dalam pada setiap pembuahan akan memiliki kemungkinan yang banyak pula. Dengan demikian untuk setiap proses penurunan sifat akan terjadi penurunan yang bervariasi, seperti kakak adik dimungkinan memiliki sifat yang berbeda
d) Regresi fillial, yaitu penurunan sifat cenderung ke arah rata-rata
2) Proses Selama Kehamilan
Periode yang sangat vital berkenaan dengan faktor hereditas ini adalah masa kehamilan. Hurlock (1997:30) mengidentifikasi empat kondisi penting yang mempengaruhi perkembangan individu pada masa selanjutnya, yaitu pembentukan sifat bawaan, jenis kelamin, jumlah anak, dan urutan kelahiran anak:
a) Sifat Bawaan
Peristiwa penting pertama dalam masa kehamilan adalah penentuan sifat bawaan, dimana peristiwa ini hanya terjadi satu kali dalam seluruh rentang kehidupan individu. Kombinasi yang terbangun antar orang tua (ayah dan ibu, serta kakek dan nenek) sangat kompleks. Penentuan sifat bawaan mempengaruhi perkembangan individu pada masa selanjutnya. Perkembangan yang dimaksud mencakup dua hal penting, yaitu faktor keturunan yang membatasi sejauhmana individu dapat berkembang, serta sifat bawaan sepenuhnya merupakan faktor kebetulan, karena tidak ada cara untuk mengendalikan jumlah kromosom ibu dan ayah yang akan diturunkan pada anak.
PPPPTK TK DAN PLB BANDUNG
© 2016
14
KP
1
b) Jenis Kelamin
Penentuan jenis kelamin individu merupakan unsur penting kedua yang terjadi pada saat pembuahan. Tiga alasan penting mengapa penentuan jenis kelamin ini menjadi sangat penting, yaitu pertama, anak-anak dalam rentang kehidupannya akan senantiasa mendapatkan tuntutan, peran, serta peran budaya sesuai jenis kelaminnya. Kedua, pengalaman belajar yang diterima anak akan sangat ditentukan oleh jenis kelaminnya. Jenis permainan, tugas-tugas yang diemban, atau pengelom-pokkan-pengelompokkan yang terjadi, sering didasari oleh jenis kelamin anak itu sendiri. Anak-anak pada jenis kelamin tertentu akan dipandang normal, selaras, atau adequate, jika melakukan berbagai peran dalam pengalaman belajarnya yang sesuai dengan jenis kelaminnya.
c) Jumlah Anak
Peristiwa penting yang ketika pada saat kehamilan atau sesudahnya adalah menentukan jumlah anak yang akan dilahirkan. Sekalipun pada umumnya ibu melahirkan satu anak, akan tetapi menurut Meredith (Hurlock, 1997:31) sering juga terjadi kelahiran yang lebih dari satu. Data-data menunjukkan 1 dari 80 kelahiran terjadi kembar dua, 1 dari setiap 9.000 kelahiran terjadi kembar 3, dan 1 dari 570.000 terjadi kelahiran kembar empat.
d) Posisi Urutan Anak
Peristiwa penting keempat dalam masa kehamilan adalah penentuan urutan anak yang baru terbentuk diantara saudara-saudara lainnya. Sekalipun demikian, urutan posisi ini sangat mungkin berubah, seiring terjadinya kehamilan berikutnya. Artinya anak-anak yang semua menempati anak bungsu, akan sangat mungkin berganti urutan karena kelahiran adiknya. Posisi urutan ini menjadi bahan pertimbangan yang penting, karena menentukan peran sosial yang akan dihadapi oleh anak di masyarakatnya.
PPPPTK TK DAN PLB BANDUNG
© 2016
15
KP
1
b. Faktor Eksternal
1) Asupan Gizi
Faktor asupan gizi memberikan pengaruh yang sangat besar terhadap perkembangan jasmani anak yang pada gilirannya akan mempengaruhi lingkup perkembangan lain, seperti lingkup intelektual, bahasa, sosial-emosional, maupun nilai-nilai agama. Anak-anak yang mengalami pertumbuhan dan perkembangan fisiknya lambat, akan memiliki banyak hambatan ketika anak melakukan kontak-kontak sosial, karena cenderung menarik diri dari lingkungan, dan sebaliknya lingkungan juga cenderung tidak banyak melibatkan, karena keterbatasan inisiatif yang dimiliki anak. Dalam konteks ini, proses tumbuh kembang anak dipengaruhi “tiga pilar utama” yaitu gizi, kesehatan dan stimulasi psikososial yang dilaksanakan secara terpadu. Macam-macam zat gizi yang penting dan fungsinya masing-masing meliputi (Dokter Kecil, 2011)
a) Karbohidrat
Karbohidrat merupakan sumber penghasil energi bagi tubuh manusia. Terdapat dua jenis karbohidrat yaitu karbohidrat sederhana dan karbohidrat kompleks. Karbohidrat sederhana terdiri dari dua bagian yaitu monosakarida dan oligosakarida. Monosakarida dikelompokan menjadi glukosa, fruktosa dan laktosa. Sumber glukosa dapat ditemui pada jenis buah-buahan, jagung manis dan madu. Fruktosa merupakan sumber karbohidrat yang paling manis sehingga sering disebut sari manis. Dan dan laktosa dapat ditemukan pada susu. Berikut beberapa fungsi karbohidrat dalam tubuh: Sumber utama energi tubuh. Pemberi rasa manis pada makanan fruktosa, glukosa, maltosa, dan laktosa. Penghemat protein maksudnya bila karbohidrat kurang dalam tubuh maka protein yang dipakai dan bila sebaliknya, maka protein dipakai untuk pertumbuhan.
PPPPTK TK DAN PLB BANDUNG
© 2016
16
KP
1
Pengatur metabolisme lemak normal. Bila karbohidrat tidak cukup maka dalam jumlah besar akan memakai lemak yang menghasilkan energi dan produk tubuh berupa asam keton. Membantu pengeluaran faeses. Dengan cara mengatur peristaltik usus dan membentuk pada faeses. Laktosa dapat menetap lebih lama dalam usus dibanding disakarida lain, hingga membantu meningkatkan pertumbuhan bakteri yang berguna dalam efek pencahar dan memproduksi vitamin-vitamin tertentu dalam usus.
Kekurangan karbohidrat dan protein Menyebabkan penyakit marasmus, dengan ciri-ciri: Wajah tampak tua (keriput dan cekung), berat badan sangat kurang, otot-otot mengecil, hampir tidak ada lapisan lemak di bawah kulit
b) Protein
Istilah Protein berasal dari bahasa Yunani “protos” yang memiliki arti “yang paling utama”. Protein memiliki peran yang sangat penting pada fungsi dan struktur seluruh sel makhluk hidup. Hal ini dikarenakan molekul protein memiliki kandungan oksigen, karbon, nitrogen, hidrogen, dan sulfur. Sebagian protein juga mengandung fosfor. Protein terbagi menjadi dua yaitu protein nabati dan protein hewani. Protein nabati berasal dari sumber makanan yang berasal dari tumbuh-tumbuhan sedangkan protein hewani berasal dari sumber makanan sepeti hewan dan ikan. Kandungan asam amino esensial protein hewani lebih besar dari pada protein nabati. Dikarenakan hal tersebut protein hewani lebih berkualitas kandungan protein yang dibutuhkan oleh tubuh. Asam amino esensial adalah substansi protein yang dibutuhkan oleh tubuh manusia, tetapi tubuh tidak dapat mensintesa sendiri, sehingga harus dikonsumsi dari luar dalam bentuk makanan. Beberapa manfaat protein tersebut adalah sebagai berikut: Sebagai enzim,protein memiliki peranan yang besar untuk mempercepat reaksi biologis.
PPPPTK TK DAN PLB BANDUNG
© 2016
17
KP
1
Sebagai alat pengangkut dan penyimpan. Protein yang terkandung dalam hemoglobin dapat mengangkut oksigen dalam eritrosit. Protein yang terkandung dalam mioglobin dapat mengangkut oksigen dalam otot. Untuk penunjang mekanis. Salah satu protein berbentuk serabut yang disebut kolagen memiliki fungsi untuk menjaga kekuatan dan daya tahan tulang dan kulit. Sebagai pertahanan tubuh atau Imunisasi pertahanan tubuh. Protein ini biasa digunakan dalam bentuk antibodi. Sebagai media perambatan impuls syaraf. Sebagai pengendalian pertumbuhan.
Kekurangan protein menyebabkan penyakit kwashiorkor (busung lapar),dengan ciri-ciri: Wajah bulat seperti bulan, wajah memelas, rambut pirang dan mudah lepas, edema (bengkak) pada kaki, otot tubuh tidak berkembang dengan baik
c) Zat Besi Kegunaan: Membentuk pigmen merah di dalam darah yang mengangkut oksigen ke dalam sel dan mengeluarkan karbondioksida dari sel, mencegah anemia, dan meningkatkan kebugaran tubuh. Sumber: Bayam, kangkung, daging merah, hati, ikan. Kekurangan zat besi menyebabkan penyakit anemia, dengan ciri-ciri: Lemah, letih dan lesu, bagian dalam kelopak mata pucat
d) Kalsium Kegunaan: Penting untuk pertumbuhan tulang dan gigi, membantu pembekuan darah pada proses penyembuhan luka, serta memastikan jantung terus berdegup. Sumber: Susu bubuk, ikan teri, bayam, kacang hijau, kacang kedelai. Kekurangan kalsium menyebabkan penyakit kerapuhan tulang dan gigi, dengan ciri-ciri: Nyeri tulang saat bergerak, tubuh bungkuk, tulang mudah patah, gigi keropos.
PPPPTK TK DAN PLB BANDUNG
© 2016
18
KP
1
e) Asam Folat Kegunaan: Sangat penting pada masa pembelahan dan pertumbuhan sel, memproduksi sel darah merah, dan mencegah anemia. Pada wanita hamil, berfungsi untuk mencegah resiko cacat susunan saraf pusat (otak dan saraf tulang belakang) pada janin. Sumber: Kacang polong, bayam, semangka, jambu biji, sereal gandum. Kekurangan asam folat menyebabkan resiko bayi lahir dengan otak dan saraf tulang belakang yang tidak sempurna (cacat lahir). Pada anak dan dewasa, dapat menyebabkan anemia.
f) Vitamin A Kegunaan: Sangat penting untuk kulit, kesehatan mata, dan menjaga daya tahan tubuh. Sumber: Wortel, jeruk, daun singkong, daun katuk, susu bubuk, telur, ikan. Kekurangan vitamin A menyebabkan penyakit kebutaan dan rabun senja.
g) Yodium Kegunaan: Mengatur metabolisme dan memproduksi energi, membantu pertumbuhan badan, penting untuk perkembangan sistem saraf. Sumber: Garam beryodium, ikan air asin, bayam. Kekurangan yodium menyebabkan penyakit gondok, kretinisme/kerdil, dan gangguan perkembangan otak.
Masalah gizi di Indonesia berdasarkan penelitian oleh para ahli gizi adalah masalah Kurang Energi Proterin (KEP). Kekurangan vitamin A dapat mengakibatkan xeropthalmia misalnya buta senja, kekurangan zat besi yang dapat menyebabkan animea, serta kekurangan yodium mengakibatkan penyakit gondok.Dari ketiga permasalahan tersebut KEP merupakan hal yang terpenting.
(Sumber :http://bppaudnibjb.org).
PPPPTK TK DAN PLB BANDUNG
© 2016
19
KP
1
2) Gangguan Fisik dan Penyakit yang Diderita
Berbagai penyakit yang diderita anak, juga mempengaruhi pertumbuhan dan perkembangannya. Hadirnya penyakit pada anak tidak terlepas dari asupan gizi yang diterima anak. Anak-anak yang mengalami gangguan penglihatan cenderung mengalami hambatan melakukan interaksi dengan teman dan orang di lingkungan sekitar. Anak tidak cepat memberikan respon, karena harus melihat reaksi orang lain terlebih dahulu. Demikian pula dengan anak yang mengalami gangguan pendengaran, bicara, serta gangguan fisik lainnya. Disamping itu, hambatan perkembangan juga sering dialami anak-anak yang mengalami penyakit, seperti demam yang sangat tinggi dan kejang-kejang.
3) Lingkungan Keluarga
Pengaruh keluarga dalam pertumbuhan dan perkembangan anak, tidak saja pada lingkup perkembangan fisik dengan memperikan asupan gizi yang memadai, akan tetapi lebih dari itu. Keluarga memberikan pengaruh yang sangat besar, terutama pada perkembangan sosial anak. Erikson (Wolfolk, 2009:103) mengidentifikasi tiga lingkup penting dalam perkembangan posikososial pada tahun-tahun prasekolah, yaitu kepercayaan dan ketidakpercayaan, pada masa bayi, otonomi versus rasa malu dan ragu-ragu, yang menandai pengendalian diri dan rasa percaya diri, serta inisiatif versus rasa bersalah yang menambahkan pada otonomi kualitas-kualitas seperti menjalankan, merencanakan, dan memecahkan tugas-tugas demi menjadi aktif dan bergerak. Dalam konteks seperti inilah peran keluarga sangat besar terhadap perkembangan anak. Senada dengan pandangan di atas, Erikson secara lengkap membagi tahap-tahap perkembangan sosial anak menjadi delapan tahapan, seperti yang disajikan pada tabel berikut ini:
PPPPTK TK DAN PLB BANDUNG
© 2016
20
KP
1
Tabel 1 1. Tahap Perkembangan Sosial Erikson Usia Tahap Perkembangan Erikson
Tahun pertama kelahiran (masa bayi)
Kepercayaan dan ketidakpercayaan
1-3 tahun (masa bayi)
Otonomi serta rasa malu dan ragu-ragu
3-5 tahun (masa prasekolah)
Prakarsa/ Inisiatif dan rasa bersalah
6 tahun-masa pubertas
Tekun/Keinginan/industry dan rasa rendah diri/inferioritas
10-20 tahun (masa remaja)
Identitas dan kebingungan identitas
20-an, 30-an tahun (masa awal dewasa)
Keintiman/keakraban dan isolasi/keterkucilan.
40-an, 50-an tahun (masa pertengahan dewasa)
Semangat berbagi/bangkit dan mandeg/ stagnasi
60-an tahun (masa akhir dewasa)
Keutuhan/Integritas ego dan keputusasaan
Sumber :Eman,S,2012 Dilihat dari fungsi keluarga, maka pengaruh keluarga terhadap perkembangan anak, dapat diklasifikasikan pada fungsi keluarga secara psikologis dan sosiologis. Secara psikologis keluarga berperan sebagai (1) pemberi rasa aman bagi anak dan anggota keluarga lainnya, (2) sumber pemenuhan kebutuhan baik fisik maupun psikis, (3) sumber kasih sayang dan penerimaan, (4) model prilaku yang tepat bagi anak untuk belajar menjadi anggota masyarakat yang baik, (5) pemberi bimbingan bagi pengembangan prilaku yang secara sosial dianggap tepat, (6) pembentuk anak dalam memecahkan masalah yang dihadapinya dalam rangka menyesuaian dirinya terhadap kehidupan, (7) pemberi bimbingan dalam belajar keterampilan motorik, verbal, dan sosial yang dibutuhkan untuk penyesuaian diri, (8) stimulator bagi pengembangan kemampuan anak untuk mencapai prestasi, baik di sekolah maupun di masyarakat, (9) pembimbing dalam mengembangan aspirasi, dan (10) sumber persahabatan/teman bermain bagi anak sampai cukup usia untuk mendapatkan teman di luar rumah.
PPPPTK TK DAN PLB BANDUNG
© 2016
21
KP
1
Sementara itu, dalam dimensi sosiologis keluarga memiliki fungsi (1) biologis dimana keluarga dipandang sebagai pranata sosial yang memberikan legalitas, kesempatan dan kemudahan bagi para anggotanya untuk memenuhi kebutuhan dasar biologisnya, (2) fungsi ekonomis dimana keluarga memiliki kewajiban untuk menafkahi anggota keluarganya, (3) fungsi edukatif, dimana keluarga berfungsi sebagai lingkungan pendidikan pertama dan utama. Keluarga juga berfungsi sebagai pengantar sosial budaya bagi anak-anaknya, (4) fungsi sosialisasi, dimana keluarga merupakan tempat penyemaian bagi masyarakat masa depan dan lingkungan keluarga merupakan faktor penentu yang sangat mempengaruhi kualitas generasi yang akan datang, (5) fungsi perlindungan, dimana keluarga berfungsi sebagai pelindung bagi anggora keluarganya dari gangguan, ancaman atau kondisi yang menimbulkan ketidaknyamanan para anggotanya, (6) fungsi rekreatif, dimana keluarga harus mampu menciptakan sebagai lingkungan yang memberikan kenyamanan, keceriaan, kehangatan dan penuh semangat bagi anggotanya, (7) fungsi agama (religi), dimana keluarga berfungsi sebagai penanam nilai-nilai agama kepada anak agar memiliki pedoman hidup yang jelas dan benar
4) Lingkungan Sekolah
Sekolah merupakan lembaga pendidikan formal yang secara sistematis, malaksanakan program bimbingan, pengajaran, dan latihan dalam membantu anak mencapai standar tingkat pencapaian perkembangan sesuai dengan rentang usia anak. Komponen lingkungan sekolah yang memberikan pengaruh terhadap pertumbuhan dan perkembangan anak usia dini diantaranya:
a) Guru dan seluruh tenaga kependidikan di sekolah
Komponen guru dan tenaga kependidikan lain di sekolah, memberikan pengaruh yang sangat besar terhadap perkembangan anak. Sikap dan perilaku guru yang mampu memberikan kenyamanan dan perlindungan bagi anak, merupakan media tumbuhkembang yang sangat baik bagi
PPPPTK TK DAN PLB BANDUNG
© 2016
22
KP
1
perkembangan seluruh lingkup perkembangan anak usia dini, terlebih bagi perkembangan lingkup sosial-emosional anak.
b) Penataan lingkungan sekolah
Mengingat anak usia dini berada pada masa penjelajahan atau eksplorasi, maka penataan lingkungan sekolah sangat mempengaruhi terwujudnya masa eksplorasi tersebut. Penataan arena bermain, penempatan alat bermain, serta mebeleir di ruangan akan memberikan dampak berkembang tidaknya kemampuan eksplorasi anak. Sekalipun demikian, penataan lingkungan sekolah, tidak hanya berkenaan dengan aspek eksplorasi, akan tetapi juga mempertimbangkan faktor keamanan bagi anak dan orang-orang yang terlibat dalam pembelajaran di sekolah.
c) Kelengkapan sarana dan prasarana pembelajaran
Stimulasi pertumbuhan dan perkembangan anak tidak dapat dilepaskan dari tersedia tidaknya sarana dan prasarana pembelajaran yang dibutuhkan. Dalam konteks ini, sarana pembelajaran yang diperlukan sesuai dengan lingkup-lingkup perkembangan anak usia dini. Oleh karena itu, sarana pembelajaran yang dibutuhkan meliputi: Sarana pembelajaran untuk pengembangan nilai-nilai agama dan moral, seperti alat-alat untuk melakukan ibadah, maket rumah ibadah, atau gambar dan poster-poster praktek ibadah. Sarana pembelajaran untuk mengembangkan lingkup fisik motorik, seperti papan atau balok titian, arena lompat, jinjit, atau senam untuk pengembangan motorik kasar. Plastisin, tanah liat, atau media playdough untuk pengembangan motorik halus. Sarana pembelajaran untuk mengembangkan lingkup kognitif, seperti aneka balok, maze, puzzle, atau alat-alat peraga sains sederhana.
PPPPTK TK DAN PLB BANDUNG
© 2016
23
KP
1
Sarana pembelajaran untuk mengembangkan bahasa, seperti aneka buku cerita anak, alat-alat video-audio, kartu huruf, suku kata dan kata serta panggung boneka. Sarana pembelajaran untuk mengembangkan lingkup sosial-emosional, seperti aneka kelengkapan bermain peran, aneka gambar ekspresi wajah, serta aneka film/video yang memuat cerita yang relevan dengan pengembangan lingkup sosial-emosional.
4. Karakteristik Perkembangan Anak Usia Dini
Dalam dunia pendidikan anak usia dini (PAUD), perkembangan anak merupakan hal yang harus diperhatikan karena perkembangan anak secara lanjut akan menentukan proses pembelajaran anak tersebut di jenjang selanjutnya. a). Karakteristik Anak Usia Dini Batasanusia anak usia dini bisa bervariasi, tergantung pada dasar yang digunakan.Pandanganmutakhiryang dianutdinegara-negaramaju,istilahanakusia dini(earlychildhood)lazimdigunakanuntukmendeskripsikananakdenganrentangusia 0-8tahun.Biladikaitkandengansistem pendidikanyangberlakudiIndonesia,rentang usia tersebut mencakup anak pada kelas-kelasrendah(1-3)diSekolahDasar,Taman Kanak-kanak(TK)danyangsederajat,KelompokBermain(Kober),dananakdi Tempat PenitipanAnak(TPA).Sesuaidengankomunitaspesertapelatihanguru/kepalaSD, ikhtisarbahasan anakusiadiniyangdimaksuddisinilebihdibatasipadaanakusiasekitar4-7tahun. b). Lingkup Perkembangan Anak Perkembangan berkenaan dengan keseluruhan kepribadian anak, karena kepribadian membentuk satu kesatuan yang terintegrasi. Secara umum dapat dibedakan beberapa aspek utama kepribadian anak, yaitu lingkup nilai agama dan moral, fisikmotorik, kognitif, bahasa, sosial emosional, dan seni. Perkembangan dari tiap lingkup
PPPPTK TK DAN PLB BANDUNG
© 2016
24
KP
1
kepribadian tidak selalu bersama-sama atau sejajar, perkembangan sesuatu lingkup mungkin mendahului atau mungkin juga mengikuti lingkup lainnya. a. Lingkup Perkembangan Nilai Agama
Pada mulanya seorang anak dilahirkan ke dunia dalam keadaan belum mengenal apa-apa, termasuk mengenal agama. Anak-anak terus tumbuh dan berkembang dalam durasi tertentu berdasarkan tahap-tahap pertumbuhan dan perkembangannya. Orang tua di rumah merupakan faktor utama dan pertama dalam menentukan kepribadian anak termasuk agamanya. Agama seorang anak pada umumnya ditentukan oleh pendidikan, pengalaman, dan latihan-latihan yang dilaluinya sejak kecil terutama oleh orang tuanya di dalam ke luarga. Dalam hal ini orang tua dapat menanamkan, menumbuhkan, dan mengembangkan dasar-dasar keimanan (keagamaan) pada diri anak-anaknya. Adapun tujuan pengembangan nilai agama pada anak-anak usia prasekolah yaitu:
1. Mengembangkan rasa iman dan cinta terhadap Tuhan.
2. Membiasakan anak-anak agar melakukan ibadah kepada Tuhan.
3. Membiasakan agar perilaku dan sikap anak didasari dengan nilai-nilai agama.
4. Membantu anak agar tumbuh dan berkembang menjadi pribadi yang beriman dan bertakwa terhadap Tuhan.
Sifat-sifat pemahaman anak usia Taman Kanak-kanak terhadap nilai-nilai keagamaan pada saat mengikuti kegiatan belajar mengajar di antaranya:
a. Unreflective: pemahaman dan kemampuan anak dalam mempelajari nilai-nilai agama sering menampilkan suatu hal yang tidak serius. Mereka melakukan kegiatan ibadah pun dengan sikap dan sifat dasar yang kekanak-kanakan. Tidak mampu memahami konsep agama dengan mendalam.
PPPPTK TK DAN PLB BANDUNG
© 2016
25
KP
1
b. Egocentris: dalam mempelajari nilai-nilai agama, anak usia Taman Kanak-kanak terkadang belum mampu bersikap dan bertindak konsisten. Anak lebih terfokus pada hal-hal yang menguntungkan dirinya.
c. Misunderstand: anak akan mengalami salah pengertian dalam memahami suatu ajaran agama yang banyak bersifat abstrak.
d. Verbalis dan Ritualis: kondisi ini dapat dimanfaatkan untuk mengembangkan nilai-nilai agama pada diri mereka dengan cara memperkenalkan istilah, bacaan, dan ungkapan yang bersifat agamis. Seperti memberi latihan menghafal, mengucapkan, memperagakan, dan sebagainya.
e. Imitative: anak banyak belajar dari apa yang mereka lihat secara langsung. Mereka banyak meniru dari apa yang pernah dilihatnya sebagai sebuah pengalaman belajar. b. Lingkup Perkembangan Nilai Moral
Ruang lingkup tahapan/pola perkembangan moral anak di antaranya adalah tahapan kejiwaan manusia dalam mengembangkan nilai moral kepada dirinya sendiri, mempersonalisasikan dan mengembangkannya dalam pembentukan pribadi yang mempunyai prinsip, serta dalam mematuhi, menentukan pilihan, menyikapi, atau melakukan tindakan nilai moral Menurut Piaget anak berpikir tentang moralitas dalam 2 cara, yaitu cara heteronomous (usia 4-7 tahun), di mana anak menganggap keadilan dan aturan sebagai sifat-sifat dunia (lingkungan) yang tidak berubah dan lepas dari kendali manusia dan cara autonomous (usia 10 tahun ke atas) di mana anak sudah menyadari bahwa aturan-aturan dan hukum itu diciptakan oleh manusia. Pengembangan nilai moral ini berfungsi untuk mencapai beberapa hal:
1) Agar perilaku dan sikap anak didasari oleh nilai moral sehingga anak dapat hidup sesuai dengan nilai-nilai yang dijunjung oleh masyarakat.
PPPPTK TK DAN PLB BANDUNG
© 2016
26
KP
1
2) Membantu anak agar tumbuh menjadi pribadi yang matang dan mandiri.
3) Melatih anak untuk dapat membedakan sikap dan perilaku yang baik dan yang tidak baik sehingga dengan sadar berusaha menghindarkan diri dari perbuatan tercela.
Ruang lingkup pengembangan moral dalam rangka pembentukan karakter menurut Ratna Megawangi adalah sebagai berikut:
a. Cinta Tuhan dan segenap ciptaanNya.
b. Tanggung jawab, Kedisiplinan dan Kemandirian.
c. Kejujuran.
d. Hormat dan Santun.
e. Dermawan, Suka menolong dan Gotong-royong/Kerjasama.
f. Percaya Diri, Kreatif dan Pekerja keras.
g. Kepemimpinan dan Keadilan.
h. Baik dan Rendah Hati.
i. Toleransi, Kedamaian dan Kesatuan.
j. 4K (kebersihan, kesehatan, kerapian dan keamanan).
Sedangkan menurut sumber dari Balitbang, Kementerian Pendidikan dan Kebudayaan, bahwa ruang lingkup nilai moral dalam rangka pembentukan karakter yang harus dikembangkan pada anak di TK adalah sebagai berikut:
a. Religius: Sikap dan perilaku yang patuh dalam melaksanakan ajaran agama yang dianutnya, toleran terhadap pelaksanaan ibadah agama lain, dan hidup rukun dengan pemeluk agama lain.
b. Jujur: Perilaku yang didasarkan pada upaya menjadikan dirinya sebagai orang yangselalu dapat dipercaya dalam perkataan, tindakan, dan pekerjaan.
c. Toleransi: Sikap dan tindakan yang menghargai perbedaan agama, suku, etnis, pendapat, sikap, dan tindakan orang lain yang berbeda dari dirinya.
d. Disiplin: Tindakan yang menunjukkan perilaku tertib dan patuh pada berbagai ketentuan dan peraturan.
PPPPTK TK DAN PLB BANDUNG
© 2016
27
KP
1
e. Kerja Keras: Perilaku yang menunjukkan upaya sungguh-sungguh dalam mengatasi berbagai hambatan belajar dan tugas, serta menyelesaikan tugas dengan sebaik-baiknya.
f. Kreatif: Berpikir dan melakukan sesuatu untuk menghasilkan cara atau hasil baru dari sesuatu yang telah dimiliki.
g. Mandiri: Sikap dan perilaku yang tidak mudah tergantung pada orang lain dalam menyelesaikan tugas-tugas.
h. Demokratis: Cara berfikir, bersikap, dan bertindak yang menilai sama Hak dan kewajiban dirinya dan orang lain.
i. Rasa Ingin Tahu: Sikap dan tindakan yang selalu berupaya untuk mengetahui lebih mendalam dan meluas dari sesuatuyang dipelajarinya, dilihat, dan didengar.
j. Semangat Kebangsaan: Cara berpikir, bertindak, dan berwawasan yang menempatkan kepentingan bangsa dan negara di atas kepentingan diri dan kelompoknya.
k. Cinta Tanah Air: Cara berfikir, bersikap, dan berbuat yang menunjukkankesetiaan, kepedulian, dan penghargaan yang tinggi terhadap bahasa, lingkungan fisik, sosial, budaya, ekonomi, dan politik bangsa.
l. Menghargai Prestasi: Sikap dan tindakan yang mendorong dirinya untuk menghasilkan sesuatu yang berguna bagi masyarakat, dan mengakui, serta menghormati keberhasilan orang lain.
m. Bersahabat/Komunikatif: Tindakan yang memperlihatkan rasa senang berbicara, bergaul, dan bekerjasama dengan orang lain.
n. Cinta Damai: Sikap, perkataan, dan tindakan yang menyebabkan orang lain merasa senang dan aman atas kehadiran dirinya.
o. Gemar Membaca: Kebiasaan menyediakan waktu untuk membaca berbagai bacaan yang memberikan kebajikan bagi dirinya.
p. Peduli Lingkungan: Sikap dan tindakan yang selalu berupaya mencegah kerusakan pada lingkungan alam di sekitarnya,
PPPPTK TK DAN PLB BANDUNG
© 2016
28
KP
1
dan mengembangkan upaya-upaya untuk memperbaiki kerusakan alam yang sudah terjadi.
q. Peduli Sosial: Sikap dan tindakan yang selalu ingin memberi bantuan pada orang lain dan masyarakat yang membutuhkan.
r. Tanggung-jawab: Sikap dan perilaku seseorang untuk melaksanakan tugas dan kewajibannya, yang seharusnya dia lakukan, terhadap diri sendiri, masyarakat, lingkungan (alam, sosial dan budaya), negara dan Tuhan Yang Maha Esa.( Balitbang Kemendiknas, 2010: 8). c. Lingkup perkembangan Fisik Motorik
Perkembangan motorik merupakan perkembangan pengendalian gerakan jasmaniah melalui kegiatan pusat syaraf, urat syaraf dan otot terkoordinasi (Hurlock: 1998). Keterampilan motorik anak terdiri atas keterampilan motorik kasar dan keterampilan motorik halus. Keterampilan motorik anak usia 4-5 tahun lebih banyak berkembang pada motorik kasar, setelah usia 5 tahun baruterjadi perkembangan motorik halus. Tujuan dari perkembangan motorik di TK, mencakup perkembangan motorik kasar dan motorik halus. Tujuan perkembangan motorik kasar di TK adalah sebagai berikut:
a) Mampu mengembangkan kemampuan motorik kasar.
b) Mampu menanamkan nilai-nilai sportifitas dan disiplin.
c) Mampu meningkatkan kesegaran jasmani.
d) Mampu memperkenalkan sejak dini hidup sehat.
e) Mampu memperkenalkan gerakan-gerakan melalui irama musik. Tujuan Perkembangan motorik halus di TK adalah sebagai berikut:
a) Mampu mengembangkan kemampuan motorik halus yang berhubungan dengan keterampilan gerak kedua tangan.
b) Mampu memperkenalkan gerakan jari seperti; menulis, menggambar, dan memanipulasi benda-benda dengan jari-jemari sehingga anak menjadi terampil dan matang.
PPPPTK TK DAN PLB BANDUNG
© 2016
29
KP
1
c) Mampu mengkoordinasikan kecepatan/kecekatan tangan dengan gerakan mata.
Fungsi perkembangan motorik kasar dan halus di TK Setelah Anda mengetahui tujuan dari perkembangan motorik kasar dan halus, maka Anda harus mengetahui fungsi dari perkembangannya. Fungsi perkembangan motorik kasar adalah:
a) Alat pemacu pertumbuhan dan perkembangan jasmani, rohani dan kesehatan untuk anak TK.
b) Alat untuk membentuk dan membangun serta memperkuat tubuh.
c) Melatih keterampilan dan ketangkasan gerak, juga daya berfikir.
d) Alat untuk meningkatkan perkembangan emosional.
e) Alat untuk meningkatkan perkembangan sosial.
f) Menumbuhkan perasaan senang dan memahami manfaat kesehatan pribadi. Fungsi perkembangan motorik halus di TK adalah:
a) Alat untuk mengembangkan kemampuan motorik halus yang berhubungan dengan keterampilan gerak kedua tangan.
b) Alat untuk meningkatkan gerakan jari seperti; menulis, menggambar, dan memanipulasi benda-benda dengan jari-jemari sehingga anak menjadi terampil dan matang.
c) Alat untuk melatih mengkoordinasikan kecepatan/kecekatan tangan dengan gerakan mata.
d) Alat untuk melatih penguasaan emosi. d. Lingkup perkembangan Kognitif
Pada saat memasuki usia 3 tahun biasanya seorang anak akan semakin mandiri dan mulai mendekatkan diri pada teman-teman sebayanya. Pada tahapan usia ini mulai menyadari apa yang ia rasakan dan apa yang telah mampu dilakukan dan belum
PPPPTK TK DAN PLB BANDUNG
© 2016
30
KP
1
mampu ia lakukan. Kesadaran itu didukung oleh kemampuanya yang pesat dalam perkembangan bahasa perbendaharaan katanya, sudah cukup banyak untuk mengomunikasikan keinginannya. Rasa egosentrisnya masih kuat, anak merasakan bahwa dirinya “pusat dunia”, dan semua hal yang ada di dunia tersedia untuk memenuhi kebutuhannya. Perilaku anak usia 3 tahun diwarnai imajinasi, umumnya mereka masih sulit untuk membedakan antara imajinasi dengan realitas. Keadaan ini semua membuatnya tampak seperti pembual kecil, sebagian dari mereka bahkan sering kali memilki teman imajiner. Pada tahapan selanjutanya, sekitar usia 4 tahun seorang anak semakin bersemangat untuk mempelajari hal baru. Keadaan ini ditandai dengan semakin seringnya anak mengajukan pertanyaan sebagai wujud dari rasa keingintahuan, seperti: “kenapa adik bayi harus minum susu ibu” atau “bagaimanakah terjadinya pelangi?”. Rasa ingin tahu anak semakin hari akan semakin banyak dengan variasi pertanyaan yang juga semakin kompleks termasuk juga masalah seksual. Suatu hari, anak mungkin akan bertanya: “bagaimana cara ia hadir kedunia?” Bahkan bukan tidak mungkin akan didapati seorang anak sedang memegang atau memeriksa alat genitalnya. Sebagai orang tua tentunya akan merasa bingung atau kesal dengan polah tingkah anaknya. Pada umumnya di akhir usia yang keempat, daya khayal anak semakin menipis seiring denga meningkatnya kemampuan memahami realitas. Menurut Sigmud Freud, rentang usia 3-5 mulai mengamati bentuk tubuhnya dan juga tubuh orang lain: perkembangan kepribadiannya juga makin kompleks. Sifat egosintrisnya menjadi kuat; pada masa ini juga anak memiliki rasa bangga, kacau, dan kebencian.
Berikut karakteristik perkembangan kognitif anak usia 3-4 tahun sampai usia 5-6 tahun berdasarkan teori-teori yang dikemukakan oleh para ahli di atas dan tugas perkembangan pada masa anak prasekolah:
PPPPTK TK DAN PLB BANDUNG
© 2016
31
KP
1
Memahami konsep makna berlawanan: kosong/penuh atau ringan/berat. Menunjukan pemahaman mengenai di dasar/di puncak; di belakang/ di depan; di atas/di bawah. Mampu memadankan bentuk lingkaran atau persegi dengan objek nyata atau gambar. Sengaja menumpuk kotak atau gelang sesuai ukuran. Mengelompokan benda yang mempunyai persamaan; warna, bentuk, atau ukuran. Mampu mengetahui dan menyebutkan umurnya. Memasangkan dan menyebutkan benda yang sama, misalnya: “apa pasangannya cangkir”. Mencocokan segi tiga, persegi dan wajik. Menyebutkan lingkaran dan kotak jika diperlihatkan. Memahami konsep lambat/cepat, sedikit/banyak,tipis/tebal, sempit/ luas. Mampu memahami apa yang harus dilakukan jika tali sepatu lepas, jika haus dan jika mau ke luar saat hujan. Mampu menerangkan, mengapa seseorang memiliki: kunci, lemari, pakaian, mobil, dan lain-lain. Menyentuh dan menghitung 4-7 benda. Merangkai kegiatan sehari-hari dan menunjukan kapan setiap kegiatan dilakukan. Mengenal huruf kecil dan huruf besar. Mengenali dan membaca tulisan yang sering kali dilihat di sekolah dan di rumah. Mampu menerangkan fungsi profesi-profesi yang ada di masyarakat, seperti: dokter, perawat, petugas pos, petugas pemadam kebakaran, dan lain-lain. Mengenali dan menghitung angka sampai 20. Mengetahui letak jarum jam untuk kegiatan sehari-hari. Melengkapi 5 analogi yang berlawanan: es itu dingin; api itu panas.
PPPPTK TK DAN PLB BANDUNG
© 2016
32
KP
1
Memperkirakan hasil yang realistis untuk setiap cerita. Menceritakan kembali buku cerita bergambar dengan tingkat kecepatan yang memadai. Menceritakan kembali 3 gagasan utama dari suatu cerita. Paham mengenai konsep arah: di tengah/di pojok/dan kiri/kanan. Mengklasifikasikan angka, tulisan, buah dan sayur. e. Lingkup perkembangan Bahasa
Bahasa merupakan sarana berkomunikasi dengan orang lain. Dalam pengertian ini tercakup semua cara untuk berkomunikasi, dimana pikiran dan perasaan dinyatakan dalam bentuk tulisan, lisan, isyarat atau gerak dengan menggunakan kata-kata, kalimat bunyi, lambang, gambar atau lukisan. Dengan bahasa semua manusia dapat mengenal dirinya, sesama manusia, alam sekitar, ilmu pengetahuan dan nilai-nilai moral atau agama. Pada usia 4-6 tahun kemampuan berbahasa anak akan berkembang sejalan dengan rasa ingin tahu serta sikap antusias yang tinggi, sehingga timbul pertanyaan- pertanyaan dari anak dengan kemampuan bahasanya. Kemampuan berbahasa juga akan terus berkembang sejalan dengan intensitas anak pada teman sebayanya. Hal ini mengimplikasikan perlunya anak memiliki kesempatan yang luas dalam menentukan sosialisasi dengan teman-temannya. Dengan memperlihatkan suatu minat yang meningkat terhadap lingkup-lingkup fungsional bahasa tulis, ia senang mengenal kata-kata yang menarik baginya dan mencoba menulis kata yang sering ditemukan. Anak juga senang belajar menulis namanya sendiri atau kata-kata yang berhubungan dengan sesuatu yang bermakna baginya. Antara usia 4 dan 5 tahun, kalimat anak sudah terdiri dari empat sampai lima kata. Mereka juga mampu menggunakan kata depan seperti di bawah, di dalam, di atas dan di samping. Mereka lebih banyak menggunakan kata kerja daripada kata
PPPPTK TK DAN PLB BANDUNG
© 2016
33
KP
1
benda. Antara 5 dan 6 tahun, kalimat anak sudah terdiri dari enam sampai delapan kata. Mereka juga sudah dapat menjelaskan arti kata-kata yang sederhana, dan juga mengetahui lawan kata. Mereka juga dapat menggunakan kata penghubung, kata depan dan kata sandang. Pada masa akhir usia prasekolah anak umumnya sudah mampu berkata-kata sederhana dan berbahasa sederhana, cara bicara mereka telah lancar, dapat dimengerti dan cukup mengikuti tata bahasa walaupun masih melakukan kesalahan berbahasa. f. Lingkup Perkembangan Sosial Emosional
Perilaku sosial merupakan aktivitas dalam berhubungan dengan orang lain, baik dengan teman sebaya, guru, orang tua maupun saudara-saudaranya.Di dalam hubungan dengan orang lain, terjadi peristiwa-peristiwa yang sangat bermakna dalam kehidupannya yang dapat membantu pembentukan kepribadiannya. Sejak kecil anak telah belajar cara berperilaku sosial sesuai dengan harapan orang-orang yang paling dekat dengannya, yaitu dengan ibu, ayah, saudara, dan anggota keluarga yang lain. Apa yang telah dipelajari anak dari lingkungan keluarganya turut mempengaruhi pembentukan perilaku sosialnya. Menurut Elizabeth B. Hurlock (1978:228) untuk menjadi orang yang mampu bersosialisasi memerlukan tiga proses. Masing-masing proses terpisah dan sangat berbeda satu sama lain, tetapi saling berkaitan. Kegagalan dalam satu proses akan menurunkan kadar sosialisasinya. Ketiga proses sosialisasi tersebut adalah:
a) Belajar berperilaku yang dapat diterima secara sosial.
Setiap kelompok sosial mempunyai standar bagi para anggotanya tentang perilaku yang dapat diterima. Untuk dapat besosialisasi anak tidak hanya harus mengetahui perilaku yang dapat diterima, tetapi mereka juga harus menyesuaikan perilakunya dengan patokan yang dapat diterima.
PPPPTK TK DAN PLB BANDUNG
© 2016
34
KP
1
b) Memainkan peran sosial yang dapat diterima.
Setiap kelompok sosial mempunyai pola kebiasaan yang telah ditentukan dengan seksama oleh para anggotanya dan dituntut untuk dipatuhi. Sebagai contoh, ada peran yang telah disetujui bersama bagi orang tua dan anak serta ada pula peran yang telah disetujui bersama bagi guru dan murid. Anak dituntut untuk mampu memainkan peran-peran sosial yang diterimanya.
c) Perkembangan sikap sosial. Untuk bersosialisasi dengan baik anak-anak harus menyenangi orang dan kegiatan sosial. Jika mereka dapat melakukannya, mereka akan berhasil dalam penyesuaian sosial dan diterima sebagai anggota kelompok sosial tempat mereka bergaul. Pola perilaku sosial menurut Elizabeth. B. Hurlock (1978:239) terbagi atas dua kelompok, yaitu pola perilaku sosial dan pola perilaku tidak sosial. Pola perilaku yang termasuk dalam perilaku sosial adalah mampu bekerja sama, dapat bersaing secara positif, mampu berbagi pada yang lain, memiliki hasrat terhadap penerimaan sosial, simpati, empati, mampu bergantung secara positif pada orang lain, bersikap ramah, tidak mementingkan diri sendiri, mampu meniru hal-hal positif, dan memiliki perilaku kelekatan (attachment behavior) yang baik. Sedangkan perilaku yang tidak sosial ditandai dengan negativisme, agresi, pertengkaran, mengejek dan menggertak, sok berkuasa, egosentrisme, berprasangka dan antagonisme jenis kelamin. Menurut Elizabeth B. Hurlock (1978:79) reaksi yang tidak menyenangkan pada bayi dapat diperoleh dengan cara mengubah posisi tubuh secara tiba-tiba, membuat suara keras, atau membiarkan bayi menggunakan popok yang basah. Rangsangan ini menimbulkan reaksi emosional berupa
PPPPTK TK DAN PLB BANDUNG
© 2016
35
KP
1
tangisan dan aktivitas yang kuat. Sebaliknya, reaksi emosional yang menyenangkan dapat tampak jelas tatkala bayi menyusu pada ibunya. Dengan meningkatnya usia anak, reaksi emosional anak mulai kurang menyebar, dan dapat lebih dibedakan. Misalnya, anak menunjukkan reaksi ketidaksenangannya dengan menjerit dan menangis, kemudian reaksi mereka berkembang menjadi perlawanan, melempar benda, mengejangkan tubuh, lari menghindar, bersembunyi dan mengeluarkan kata-kata. Dengan bertambahnya usia, reaksi emosional yang berwujud kata-kata semakin meningkat, sedangkan reaksi gerakan otot mulai berkurang. Menurut Elizabeth B. Hurlock (1978:94) emosi anak memiliki karakteristik- karakteristik sebagai berikut :
a) Emosi yang kuat
Anak kecil bereaksi terhadap suatu stimulusi dengan intensitas yang sama, baik terhadap situasi yang remeh maupun yang sulit. Anak belum mampu menunjukkan reaksi emosional yang sebanding terhadap stimulasi yang dialaminya.
b) Emosi seringkali tampak
Anak-anak seringkali tidak mampu menahan emosinya, cenderung emosi anak nampak dan bahkan berlebihan.
c) Emosi bersifat sementara
Emosi anak cenderung lebih bersifat sementara, artinya dalam waktu yang relatif singkat emosi anak dapat berubah dari marah kemudian tersenyum, dari ceria berubah menjadi murung.
d) Reaksi emosi mencerminkan individualitas
Semasa bayi, reaksi emosi yang ditunjukkan anak relatif sama. Secara bertahap, dengan adanya pengaruh faktor belajar dan lingkungan, perilaku yang menyertai berbagai emosi anak semakin diindividualisasikan. Seorang anak akan
PPPPTK TK DAN PLB BANDUNG
© 2016
36
KP
1
berlari ke luar dari ruangan jika mereka ketakutan, sedangkan anak lainnya mungkin akan menangis atau menjerit.
e) Emosi berubah kekuatannya
Dengan meningkatnya usia, emosi anak pada usia tertentu berubah kekuatannya. Emosi anak yang tadinya kuat berubah menjadi lemah, sementara yang tadinya lemah berubah menjadi emosi yang kuat. Hal ini disebabkan karena adanya perubahan dorongan, perkembangan intelektual dan perubahan minat dan sistem nilai.
f) Emosi dapat diketahui melalui gejala perilaku Emosi yang dialami anak dapat pula dilihat dari gejala perilaku anak seperti: melamun, gelisah, menangis, sukar berbicara atau dari tingkah laku yang gugup seperti menggigit kuku atau menghisap jempol. Ekspresi emosi yang baik pada anak dapat menimbulkan penilaian sosial yang menyenangkan, sedangkan ekspresi emosi yang kurang baik seperti cemburu, marah, atau takut dapat menimbulkan penilaian sosial yang tidak menyenangkan g. Lingkup Perkembangan Seni
Berdasarkan Pedoman Pengembangan Program Pembelajaran Di Taman Kanak-kanak tahun 2010, pembelajaran melalui seni bertujuan agar anak dapat dan mampu menciptakan sesuatu berdasarkan hasil imajinasinya dan dapat menghargai atau mengapresiasi karya orang lain secara kreatif. Pengembangan berbagai bidang pengembangan melalui seni dapat melatih daya imajinasi, kreasi, apresiasi, serta untuk mengembangkan kepribadian dan kehalusan budi. Sumanto (2005), menyatakan bahwa fungsi didik seni dalam pendidikan di TK adalah:
1) Sebagai media ekspresi, yaitu mengungkapkan keinginan, perasaan, pikiran melalui berbagai bentuk aktivitas seni secara kreatif yang dapat menimbulkan kesenangan, kegembiraan dan kepuasan anak.
PPPPTK TK DAN PLB BANDUNG
© 2016
37
KP
1
2) Sebagai media komunikasi, melalui aktivitas berekspresi seni bagi anak merupakan suatu cara untuk menyampaikan sesuatu kepada orang lain yang diwujudkan dalam bentuk karyanya.
3) Sebagai media bermain, maksudnya media yang dapat memberikan kesenangan, kebebasan untuk mengembangkan perasaan, kepuasan, keinginan, keterampilan seperti pada saat bermain.
4) Sebagai media pengembangan bakat seni, hal ini didasarkan bahwa semua anak punya potensi/bakat yang harus diberikan kesempatan sejak awal untuk dipupuk/dikembangkan melalui aktivitas senirupa dan kerajinan tangan sesuai kemampuannya. Meskipun kadar potensi/ bakat setiap anak bisa berbeda dan juga berhubungan secara tidak langsung dengan kecerdasannya.
5) Sebagai media untuk mengembangkan kemampuan berpikir, yaitu penyaluran daya nalar yang dimiliki anak untuk digunakan dalam melakukan kegiatan seni. Anak yang cerdas,cakap kemampuan pikirnya dapat menjadi pemicu munculnya daya kreativitas seni.
6) Sebagai media untuk memperoleh pengalaman estetis dimana melalui aktivitas penghayatan, apresiasi, ekspresi dan kreasi seni di TK dapat memberikan pengalaman untuk menumbuhkan sensitivitas keindahan dan nilai seni
Berdasarkan pedoman pembelajaran pengembangan seni, pembelajaran seni dan kreativitas menekankan pada lingkup eksplorasi, ekspresi, dan apresiasi. Lingkup-lingkup tersebut dijelaskan sebagai berikut.
a. Eksplorasi
Secara umum, eksplorasi bertujuan agar anak dapat:
(1) Melakukan observasi dan mengeksplorasi alam semesta dan diri manusia.
(2) Mengeksplorasi elemen-lemen dari seni dan musik.
PPPPTK TK DAN PLB BANDUNG
© 2016
38
KP
1
(3) Mengeksplorasi tubuh mereka apakah sanggup dalam mengerjakan sesuatu yang keatif.
b. Ekspresi
Secara umum, ekspresi bertujuan agar anak dapat:
(1) Mengekspresikan dan menggambarkan benda, ide, dan pengalaman menggunakan jenis media seni instrumen musik, dan gerak.
(2) Menambah percaya diri dalam mengekspresikan kreasi mereka sendiri.
c. Apresiasi
Apresiasi bertujuan agar anak dapat menilai dan menanggapi ragam seni dan produksi kerajinan serta pengalaman seni.
D. Aktivitas Pembelajaran
Kegiatan 1
:
Karakteristik Perkembangan Anak TK
Media
:
1. Bahan Presentasi
2. LK -01
3. Kertas Plano dan Kelengkapannya
Langkah-langkah Pembelajaran:
1. Pelatih memberikan pengantar singkat tentang Karakteristik perkembangan Anak TK dilihat dari 6 lingkup perkembangan.
2. Peserta diminta untuk membentuk 5 (lima) kelompok dan mendiskusikan LK-01 tentang Lingkup Perkembangan Anak sesuai dengan karakteristik perkembangannya
3. Hasil Diskusi di tuliskan pada kertas plano
4. Setiap kelompok menempelkan hasil diskusi di dinding ruangan dan ada seorang anggota kelompok yang bertugas untuk melayani peserta yang melakukan window shopping
5. Semua peserta berkunjung ke setiap kelompok secara bergiliran untuk mengomentari hasil diskusi kelompok lain.
6. Pelatih memberikan penguatan
PPPPTK TK DAN PLB BANDUNG
© 2016
39
KP
1
LEMBAR KERJA 1.1 KARAKTERISTIK PERKEMBANGAN ANAK TK 1. Tujuan: Peserta mampu mengidentifikasi karakteristik perkembangan anak TK dilihat dari 6 lingkup perkembangannya. 2. Langkah Kerja: a. Identifikasilah karakteristik perkembangan anak TK dilihat dari 6 lingkup perkembangannya melalui diskusi dengan kelompok b. Tuliskanlah hasilnya dalam tabel yang telah disediakan. c. Presentasikanlah hasilnya di depan kelas kepada kelompok yang lain oleh perwakilan kelompok Tabel LK- 1.1 Karakteristik Perkembangan Anak TK
No Lingkup Perkembangan Karakteristik Perkembangan
1
Nilai Agama dan Moral
2
Fisik Motorik
3
Kognitif
4
Bahasa
5
Sosial Emosional
6
Seni
PPPPTK TK DAN PLB BANDUNG
© 2016
40
KP
1
E. Latihan/Kasus/Tugas
Jawablah Pertanyaan di bawah ini dengan benar!
1. Manakah pernyataan di bawah ini yang tidak benar, berkenaan dengan konsepsi bahwa pertumbuhan lebih bersifat kuantitatif dan perkembangan lebih kearah kualitatif.....
A. Pertumbuhan diindikasikan oleh penambahan tinggi badan.
B. Perkembangan diindikasikan oleh peningkatan kemampuan anak berberdiri..
C. Perkembangan diindikasikan oleh perubahan dalan ukuran.
D. Pertumbuhan diindikasikan oleh kesiapan anak memasuki pendidikan lanjutan.
2. Manakah pernyataan di bawah ini yang benar ?
A. Hereditas merupakan faktor pertama yang mempengaruhi individu dibandingkan lingkungan.
B. Faktor hereditas yang diturunkan orang tua lebih mengarah pada prilaku dari pada struktur.
C. Faktor lingkungan jauh lebih besar pengaruhnya dibandingkan faktor hereditas.
D. Faktor hereditas memiliki pengaruh yang jauh lebih besar dibandingkan lingkungan.
3. Salah satu contoh teknik pembelajaran seni dan kreativitas, dimana anak mengungkapkan perasaan hatinya melalui menggambar dan bermain musik, adalah...
A. Eksplorasi
B. Ekspresi
C. Apresiasi
D. Eksposisi
4. Beberapa indikator yang tidak termasuk anak yang memiliki kesiapan secara sosial dan emosi untuk masuk ke sekolah dasar adalah...
A. anak memiliki percaya diri, sikap bersahabat, dan dapat bergaul dengan temannya secara baik
B. anak dapat berkonsentrasi dan tekun dalam melaksanakan tugas yang diberikan kader/guru/orang dewasa lain yang dekat dengan anak
PPPPTK TK DAN PLB BANDUNG
© 2016
41
KP
1
C. anak tidak dapat mengutarakan perasaan kecewa, marah dan rasa senangnya melalui bahasa
D. anak mau mendengarkan dan memahami perintah yang diberikan
5. Seorang anak usia 4-5 tahun mengalami kekalahan ketika mengikuti suatu perlombaan bersama temannya, tetapi anak tersebut mampu menerima kekalahannya dengan tidak menangis yang berlebihan dan mau mengakui kelebihan temannya, maka anak tersebut sudah berkembang aspek perkembangan...
A. Sosial emosional dalam hal rasa tanggung jawab untuk diri sendiri dan orang lain
B. Sosial emosional dalam sikap menghargai orang lain
C. Sosial emosional dalam hal kesadaran diri
D. sosial emosional dalam hal kejujuran
F. Rangkuman
1 Dilihat dari perbedaan antara pertumbuhan dan perkembangan, dapat dikatakan bahwa pertumbuhan lebih berorientasi pada perubahan secara fisik sedangkan perkembangan lebih mengarah pada perubahan secara psikologis.
2 Prinsip-prinsip Perkembangan
a. Perkembangan berlangsung secara kontinyu dan tidak terputus
b. Perkembangan berlangsung dalam urutan terpola
c. Irama dan tempo perkembangan bersifat individual
d. Perkembangan bergerak dari yang umum ke yang khusus
e. Hasil proses belajar tergantung pada tingkat kematangan yang dicapai
f. Faktor-faktor hereditas dan lingkungan memiliki pengaruh yang sama kuatnya terhadap proses perkembangan
g. Perkembangan dapat mengalami kemunduran dan dapat pula dipercepat dalam batas-batas tertentu
h. Pada usia tertentu terdapat perbedaan perkembangan/pertumbuhan antara anak laki-laki dengan anak perempuan
i. Bagian sifat-sifat individu dalam perkembangannya saling berkorelasi secara positif
PPPPTK TK DAN PLB BANDUNG
© 2016
42
KP
1
j. Setiap individu yang normal akan melewati segenap fase perkembangan
3. Faktor-faktor yang mempengaruhi Pertumbuhan dan perkembangan:
a. Faktor internal
b. Faktor eksternal
4. Perkembangan berkenaan dengan keseluruhan kepribadian anak, karena kepribadian membentuk satu kesatuan yang terintegrasi. Secara umum dapat dibedakan beberapa aspek utama kepribadian anak, yaitu lingkup nilai agama dan moral, fisikmotorik, kognitif, bahasa, sosial emosional, dan seni.
5. Perkembangan dari tiap lingkup kepribadian tidak selalu bersama-sama atau sejajar, perkembangan sesuatu lingkup mungkin mendahului atau mungkin juga mengikuti lingkup lainnya.
G. Umpan Balik dan Tindak Lanjut
Cocokkanlah jawaban Anda dengan kunci jawaban yang terdapat di bagian akhir kegiatan pembelajaran ini. Hitunglah jawaban Anda yang benar kemudian gunakan rumus di bawah ini untuk mengetahui tingkat penguasaan Anda terhadap materi pada kegiatan pembelajaran 1. Rumus: Arti tingkat penguasaan yang anda capai: 90 – 100 % = baik sekali 80 – 90% = baik 70 – 79% = cukup < 70% = kurang Apabila anda mencapai tingkat pencapaian penguasaaan lebih dari 80%, anda dapat melanjutkan ke kegiatan pembelajaran selanjutnya. Apabila penguasaan anda masih dibawah 80% anda harus mengulangi materi pada kegiatan pembelajaran 1 ini terutama bagian yang belum anda kuasai.
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
43
KEGIATAN PEMBELAJARAN 2 TUGAS PERKEMBANGAN ANAK TK
A. Tujuan
Tujuan pembelajaran pada kegiatan pembelajaran 2 ini adalah agar peserta diklat mampu mengorganisasikan lingkup perkembangan sesuai dengan karakteristik anak usia dini.
B. Indikator Pencapaian Kompetensi
Setelah mengikuti seluruh kegiatan pembelajaran 2 ini kompetensi atau kinerja yang harus dikuasai adalah peserta mampu mengelompokkan anak usia dini sesuai dengan kebutuhan pada 6 lingkup perkembangan yaitu perkembangan nilai agama dan moral, fisik/motorik, kognitif, bahasa, sosial emosional, dan seni.
C. Uraian Materi
1. Pengertian dan sumber Tugas-tugas Perkembangan.
Robert Havighurts (Adam & Gullota.1983) melalui perspektif psikososial berpendapat bahwa periode yang beragam dalam kehidupan individu menuntut untuk menuntaskan tugas-tugas perkembangan yang khusus.Tugas-tugas ini berkaitan erat dengan perubahan kematangan,persekolahan,pekerjaan,pengalaman beragamadan hal lainnya sebagai prasyarat untuk pemenuhan dan kebahagaian hidupnya. Selanjutnya Havighurst (1961) mengartikan tugas-tugas perkembangan itu sebagai berikut: A developmental task is a task which arises at or about a certain period in the life of the individual,successfull achievement of wich leads to unhappiness in the individual,disapproval by society, and difficulty with later task.
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
44
Maksudnya,bahwa tugas perkembangan itu merupakan suatu tugas yang muncul pada periode tertentu dalam rentang kehidupan individu,yang apabila tugas itu dapat berhasil dituntaskan akan membawa kebahagiaan dan kesuksesan dalam menuntaskan tugas berikutnya; sementara apabila gagal,maka akan menyebabkan ketidakbahagiaan pada diri individu yang bersangkutan,menimbulkan penolakan masyarakat, dan kesulitan-kesulitan dalam menuntaskan tugas-tugas berikutnya. Tugas-tugas perkembangan ini berkaitan dengan sikap,perilaku,atau keterampilan yang seyogyanya dimiliki oleh individu sesuai dengan usia atau fase perkembangannya. Hurlock (1981) menyebut tugas-tugas perkembangan ini sebagai sosial expectations. Dalam arti setiap kelompok budaya mengharapkan anggotanya menguasai keterampilan tertentu yang penting dan memperoleh pola perilaku yang disetujui bagi berbagai usia sepanjang rentang kehidupan.
2. Munculnya tugas-tugas perkembangan,bersumber pada faktor-faktor berikut:
1. Kematangan fisik,misalnya (a) belajar berjalan karena kematangan otot-otot kaki; (b) belajar bertingkah laku,bergaul dengan jenis kelamin yang berbeda pada masa remaja karena kematangan organ-organ seksual.
2. Tuntutan masyarakat secara kultural. Misalnya (a) belajar membaca; (b) belajar menulis; (c)belajar berhitung; (d) belajar berorganisasi.
3. Tuntutan dari dorongan dan cita-cita individu sendiri,misalnya (a) memilih pekerjaan; (b) memilih teman hidup
4. Tuntutan norma agama, misalnya (a) taat beribadah kepada Allah; (b) berbuat baik kepada sesama manusia.
Tugas-tugas Perkembangan Anak Usia Dini.
Tugas perkembangan merupakan suatu tugas yang muncul dalam suatu periode tertentu dalam kehidupan individu. Tugas tersebut harus dikuasai dan diselesaikan oleh individu, sebab tugas perkembangan ini akan sangat mempengaruhi pencapaian perkembangan pada masa perkembangan berikutnya. Menurut Havighrust, jika seorang individu gagal menyelesaikan
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
45
tugas perkembangan pada fase tertentu, maka ia akan mengalami kegagalan dalam pencapaian tugas perkembangan pada masa berikutnya. Pada setiap masa perkembangan individu, ada berbagai tugas perkembangan yang harus dikuasai, adapun tugas perkembangan masa kanak-kanak menurut Carolyn Triyon dan J.W. Lilienthal (Hildebrand 1986:45) adalah sebagai berikut :
a) Berkembang menjadi pribadi yang mandiri. Anak belajar untuk berkembang menjadi pribadi yang bertanggung jawab dan dapat memenuhi segala kebutuhannya sendiri sesuai dengan tingkat perkembangannya di usia Taman Kanak-kanak.
b) Belajar memberi, berbagi dan memperoleh kasih sayang.Pada masa Taman Kanak-kanak ini anak belajar untuk dapat hidup dalam lingkungan yang lebih luas yang tidak hanya terbatas pada lingkungan keluarga saja, dalam masa ini anak belajar untuk dapat saling memberi dan berbagi dan belajar memperoleh kasih sayang dari sesama dalam lingkungannya.
c) Belajar bergaul dengan anak lain. Anak belajar mengembangkan kemampuannya untuk dapat bergaul dan berinteraksi dengan anak lain dalam lingkungan di luar lingkungan keluarga.
d) Mengembangkan pengendalian diri. Pada masa ini anak belajar untuk bertingkah laku sesuai dengan tuntunan lingkungan. Anak belajar untuk mampu mengendalikan dirinya dalam berhubungan dengan orang lain. Pada masa ini anak juga perlu menyadari bahwa apa yang dilakukannya akan menimbulkan konsekuensi yang harus dihadapinya.
e) Belajar bermacam-macam peran orang dalam masyarakat. Anak belajar bahwa kehidupan bermasyarakat ada berbagai jenis pekerjaan yang dapat dilakukan yang dapat menghasilkan sesuatu yang dapat memenuhi kebutuhannya dan dapat menghasilkan jasa bagi orang lain. Contoh, seorang dokter mengobati orang sakit, guru mengajar anak-anak di kelas, pak polisi mengatur lalu lintas, dan lain sebagainya.
f) Belajar untuk mengenal tubuh masing-masing. Pada masa ini anak perlu mengetahui berbagai anggota tubuhnya, apa fungsinya dan bagaimana menggunakannya. Contoh, mulut untuk makan dan berbicara, telinga untuk mendengar, mata untuk melihat dan sebagainya.
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
46
g) Belajar menguasai keterampilan motorik kasar dan halus. Anak belajar mengkoordinasikan otot-otot yang ada pada tubuhnya, baik otot kasar maupun otot halus. Kegiatan yang memerlukan koordinasi otot kasar diantaranya berlari, melompat, menendang, menangkap bola dan sebagainya. Sedangkan kegiatan yang memerlukan koordinasi otot halus adalah perkerjaan melipat, menggambar, meronce, dan sebagainya.
h) Belajar mengenal lingkungan fisik dan mengendalikan. Pada masa ini diharapkan anak mampu mengenal benda-benda yang ada di lingkungannya, dan dapat menggunakannya secara tepat. Contoh, anak belajar mengenai ciri-ciri benda berdasarkan ukuran, bentuk, dan warnanya. Selain dari itu, anak dapat membandingkan satu benda dengan benda lain berdasarkan ciri-ciri yang dimiliki benda tersebut.
i) Belajar mengusai kata-kata baru untuk memahami anak/orang lain. Anak belajar menguasai bebagai kata-kata baik baik yang berkaitan dengan benda-benda yang ada di sekitarnya, ataupun berinteraksi dengan lingkungannya. Contoh, anak dapat menyebutkan nama suatu benda, atau mengajak anak lain untuk bermain, dan sebagainya.
j) Mengembangkan perasaan positif dalam hubungan dengan lingkungan. Pada masa ini anak belajar mengembangkan perasaan kasih sayang terhadap apa-apa yang ada dalam lingkunga, seperti pada teman sebaya, saudara, binatang kesayangan atau pada benda-benda yang dimilikinya.
Tugas-tugas Perkembangan pada setiap fase perkembangan Tugas-tugas perkembangan pada masa usia bayi dan kanak-kanak (0-6 tahun)
1). Belajar berjalan.Belajar berjalan terjadi pada usia antara 9 sampai 15 bulan, pada masa usia ini tulang kaki, otot dan susunan syarafnya telah matang untuk belajar berjalan sendiri.
2). Belajar makan makanan padat. Hal ini terjadi pada tahun kedua,sistem alat-alat pencernaan makanan dan alat-alat pengunyah pada mulut telah matang untuk hal tersebut.
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
47
3). Belajar berbicara,yaitu mengeluarkan suara yang berarti dan menyampaikannya kepada orang lain dengan perantaraan suara itu. Untuk itu,diperlukan kematangan otot-otot dan syaraf dari alat-alat bicara.
Ada dua pendapat mengenai cara permulaan anak dalam belajar berbicara,yaitu:
a) Pendapat pertama,mengemukakan bahwa bayi mulai belajar bicara dengan jalan mengeluarkan macam-macam suara yang tidak berarti (meraban). Kemudian orang disekitarnya akan mengajarkan kepadanya nama-nama atau kata-kata tentang sesuatu secara teratur dalam situasi tertentu sampai anak belajar mengasosiasikan (menghubung-hubungkan) suara-suara tertentu dengan benda atau situasi (perilaku) tertentu.Misalnya,suara “bapak” yang diucapkan anak secara kebetulan,kemudian oleh orang di sekitarnya diulanginya apabila sang ayah hadir di dekatnya,maka terjadilah asosiasi antara “bapak” dengan orangnya.
b) Pendapat kedua, justru sebaliknya, menurut teori ini suara bayi tidaklah secara kebetulan tetapi mempunyai arti baginya karena suara-suara itu mengekspresikan (menyatakan) perasaan-perasaannya. Perkembangan selanjutnya dari belajar bahasa ini terjadi dengan jalan meniru (imitasi).
4). Belajar buang air kecil dan buang air besar. Tugas ini dilakukan pada tempat dan waktu yang sesuai dengan norma masyarakat.
Sebelum usia 4 tahun, anak pada umumnya belum dapat mengatasi (menahan) ngompol karena perkembangan syaraf yang mengatur pembuangan belum sempurna. Untuk memberikan pendidikan kebersihan terhadap anak usia di bawah 4 tahun, cukup dengan pembiasaan saja, yaitu setiap kali mau buang air, bawalah anak ke WC, tanpa banyak memberikan penerangan kepadanya.
5). Belajar mengenal perbedaan jenis kelamin. Melalui observasi (pengamatan) anak dapat melihat tingkah laku, bentuk fisik dan pakaian yang berbeda antara jenis kelamin yang satu dengan yang lainnya. Dengan cara tersebut, anak dapat mengenal perbedaan anatomis pria
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
48
dan wanita, anak menaruh perhatian besar terhadap alat kelaminnya sendiri maupun orang lain.
6). Mencapai kestabilan jasmainiah fisiologis. Keadaan jasmani anak sangat sangat labil apabila dibandingkan dengan orang dewasa, anak cepat sekali merasakan perubahan suhu sehingga temperatur badannya mudah berubah. Untuk mencapai kestabilan jasmaniah, bagi anak diperlukan waktu sampai usia 5 tahun. Dalam proses mencapai kestabilan jasmaniah ini, orang tua perlu memberikan perawatan yang intensif, baik menyangkut pemberian makanan yang bergizi maupun pemeliharaan kebersihan.
7). Membentuk konsep-konsep (pengertian) sederhana kenyataan sosial, dan alam. Pada mulanya dunia ini bagi anak merupakan suatu keadaan yang kompleks dan membingungkan. Lama kelamaan anak dapat mengamati benda-benda atau orang-orangdi sekitarnya. Perkembangan lebih lanjut, anak menemukan keteraturan dan dapat membentuk generalisasi (kesimpulan) dari berbagai benda yang pada umumnya mempunyai ciri yang sama. Anak belajar bahwa bayangan tertentu dengan suara tertentu yang nyaring memenuhi kebutuhannya disebut “orang”,”ibu” dan “ayah”. Anak belajar bahwa benda-benda khusus dapat dikelompokkan dan diberi satu nama, seperti kucing,ayam,kambing, dan burung dapat disebut.
8). Belajar mengadakan hubungan emosional dengan orang tua, saudara dan orang lain. Anak mengadakan hubungan dengan orang-orang yang ada di sekitarnya menggunakan berbagai cara, yaitu isyarat, menirukan dan menggunakan bahasa. Cara yang diperoleh dalam belajar mengadakan hubungan emosional dengan orang lain. Apakah ia bersikap bersahabat,bersikap dingin,introvert,extrovert dan sebagainya. Misalnya, apabila anak memperoleh pergaulan dengan orang tuanya itu menyenangkan, maka cenderung akan bersikap ramah dan ceria.
9). Belajar mengadakan hubungan baik dan buruk,yang berarti mengembangkan kata hati. Anak kecil dikuasai oleh hedonisme naif, dimana kenikmatan dianggapnya baik, sedangkan penderitaan dianggapnya buruk (hedonisme adalah aliran yang menyatakan bahwa manusia dalam hidupnya bertujuan mencari kenikmatan dan
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
49
kebahagiaan). Apabila anak bertambah besar ia harus belajar pengertian tentang baik dan buruk, benar dan salah, sebab sebagai makhluk sosial (bermasyarakat), manusia tidak hanya memperhatikan kepentingan/kenikmatan sendiri saja, tetapi juga harus memperhatikan kepentingan orang lain.Anak mengenal pengertian baik dan buruk, benar dan salah ini dipengaruhi oleh pendidikan yang diperolehnya.
Kriteria Tahapan Perkembangan Dalam hubungannya dengan proses belajar mengajar (pendidikan),tahapan perkembangan yang dipergunakan sebaiknya bersifat elektif, maksudnya tidak terpaku pada suatu pendapat saja tetapi bersifat luas untuk meramu dari berbagai pendapat yang mempunyai hubungan yang erat. Berdasarkan pendirian tersebut, perkembangan individu sejak lahir sampai masa kematangan itu dapat digambarkan melewati fase-fase berikut.
Tabel 2 1. Fase-fase Perkembangan Individu
TAHAP PERKEMBANGAN
USIA
Masa usia pra sekolah Masa usia sekolah dasar Masa usia sekolah menengah Masa usia mahasiswa
0-6 6-12 12-18 18-25
Sumber :Departemen Kesehatan RI,(1995)
a. Masa Usia Prasekolah
Pada masa usia prasekolah ini dapat diperinci lagi menjadi dua masa yaitu masa vital dan masa estetik.
1) Masa vital
Pada masa ini,individu menggunakan fungsi-fungsi biologis untuk menemukan berbagai hal dalam dunianya. Untuk masa belajar, Freud menamakan tahun pertama dalam kehidupan individu itu sebagai masa oral (mulut), karena mulut dipandang sebagai sumber
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
50
kenikmatan. Anak memasukan apa saja yang dijumpai ke dalam mulutnya itu, tidaklah karena mulut merupakan sumber kenikmatan utama, tetapi karena waktu itu mulut merupakan alat untuk melakukan eksplorasi (penelitian) dan belajar. Pada tahun ke kedua anak telah belajar berjalan, dengan mulai berjalan anak akan mulai belajar menguasai ruang. Mula-mula ruang tempatnya saja, kemudian ruang dekat dan selanjutnya ruang yang jauh. Pada tahun kedua ini, umumnya terjadi pembiasaan terhadap kebersihan (kesehatan). Melalui latihan kebersihan ini, anak belajar mengendalikan impuls-impuls atau dorongan-dorongan yang datang dari dalam dirinya (umpamanya,buang air kecil dan air besar)
2) Masa estetik
Pada masa ini dianggap sebagai masa perkembangan rasa keindahan. Kata estetik disini dalam arti bahwa pada masa ini, perkembangan anak yang terutama adalah fungsi pancainderanya. Kegiatan eksploitasi dan belajar anak juga terutama menggunakan pancainderanya. Pada masa ini, indera masih peka, karena itu Montessori menciptakan bermacam-macam alat permainan untuk melatih pancainderanya. Untuk memudahkan pengamatan, para ahli membagi perkembangan anak menjadi 4 lingkup perkembangan, yaitu: perkembangan sosial-emosi, perkembangan fisik/motorik, perkembangan kognitif, dan perkembangan bahasa. Sementara itu, merujuk pada Peraturan Menteri Pendidikan dan Kebudayaan Nomor 137 Tahun 2014lingkup perkembangan anak usia dini meliputi 6 aspek yaitu: Perkembangan Nilai-nilai Agama dan Moral, Perkembangan Fisik/Motorik, Perkembangan Konitif, Perkembangan Bahasa, Perkembangan Sosial-Emosional dan Perkembangan Seni.
Formulasi tugas-tugas perkembangan dalam Permendikbud Nomor 137 Tahun 2014, dinyatakan dalam Tingkat Pencapaian Perkembangan Anak. Dalam hal ini, tingkat pencapaian perkembangan anak menggambarkan pertumbuhan dan perkembangan yang diharapkan dicapai anak pada rentang usia tertentu.Perkembangan anak yang dicapai merupakan integrasi
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
51
lingkup perkembangan nilai-nilai agama dan moral, fisik/motorik, kognitif, bahasa, sosial-emosional dan seni. Pertumbuhan anak yang mencakup pemantauan kondisi kesehatan dan gizi mengacu pada panduan kartu menuju sehat (KMS) dan deteksi dini tumbuh kembang anak.Perkembangan anak berlangsung secara berkesinambungan yang berarti bahwa tingkat perkembangan yang dicapai pada suatu tahap diharapkan meningkatbaik secara kuantitatif maupun kualitatif pada tahap selanjutnya. Tingkat pencapaian perkembangan disusun berdasarkan kelompok usia anak:0 – <2 tahun; 2 – <4 tahun; dan 4 – ≤6 tahun. Pengelompokan usia 0 – <1 tahundilakukan dalam rentang tiga bulanan karena pada tahap usia ini, perkembangan anak berlangsung sangat pesat. Pengelompokan usia 1 – <2 tahun dilakukan dalam rentangenam bulanan karena pada tahap usia ini, perkembangan anak berlangsung tidaksepesat usia sebelumnya. Untuk kelompok usia selanjutnya, pengelompokan dilakukan dalam rentang waktu per tahun. Dalam modul ini hanya akan dibahas tingkat pencapaian perkembangan anak berdasarkan kelompok usia 4 – 6 tahun berdasarkan 6 (enam) lingkup perkembangan anak sesuai Permendikbud Nomor 137 Tahun 2014 sebagai berikut: 1. Perkembangan Nilai agama dan moral
Perkembangan nilai-nilai agama dan moral berkaitan dengan cara anak mengenal, menirukan, dan mencontoh berbagai aktifitas keagamaan yang dilakukan dan distimulasikan oleh orang-orang dewasa yang ada di lingkungannya serta sifat-sifat keagamaan yang menyertainya, sesuai dengan agama dan keyakinan yang dianutnya. Dalam pendidikan anak usia dini salah satu kawasan yang harus dikembangkan adalah nilai agama moral, karena dengan diberikannya pendidikan nilai agama dan moral sejak usia dini, diharapkan pada tahap perkembangan selanjutnya anak akan mampu membedakan baik buruk, benar salah, sehingga ia dapat menerapkannya dalam kehidupan sehari-harinya. Ini akan berpengaruh pada mudah tidaknya anak diterima di masyarakat sekitarnya dalam hal bersosialisasi.Dalam perkembangan nilai
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
52
agama dan moral anak usia dini harus dilakukan dengan tepat. Jika hal ini tidak bisa dicapai, maka pesan moral yang akan disampaikan “orang tua” kepada anak menjadi terlambat. Perkembangan nilai agama moral untuk anak usia dini ini bisa dilakukan di dalam tiga tri pusat pendidikan yang ada, yaitu keluarga, sekolah dan masyarakat. Dalam pengembangan nilai moral untuk anak usia dini perlu dilakukan dengan sangat hati-hati. Untuk itulah “orang tua” harus pandai-pandai dalam memilih dan menentukan metode yang akan digunakan untuk menanamkan nilai agama, moral kepada anak agar pesan moral yang ingin disampaikan guru/orangtua dapat benar-benar sampai dan dipahami oleh anak usia dini untuk bekal kehidupannya di masa depan. Metode yang dapat digunakan sangatlah bervariasi, salah satunya adalah metode bercerita. Metode bercerita ini cenderung lebih banyak digunakan, karena anak usia dini biasanya senang jika mendengarkan cerita dari “orangtua”. Untuk bisa menarik minat anak untuk mendengarkan, tentunya cerita yang dibawakan harus tepat sesuai dengan usia anak. Cerita yang dibawakan juga memuat nilai agama dan moral yang hendak disampaikan orang tua kepada anak. Nilai dan moral dalam kamus besar bahasa Indonesia karangan Purwodarminto dinyatakan bahwa nilai adalah harga, hal-hal yang berguna bagi manusia. Tugas-tugas perkembangan yang diharapkan dicapai pada aspek perkembangan nilai-nilai agama dan moral rentang usia 4-5 tahun sesuai dengan Permendikbud Nomor 137 Tahun 2014 adalah: a. Mengetahui agama yang dianutnya b. Meniru gerakan beribadah dengan urutan yang benar c. Mengucapkan doa sebelum dan/atau sesudah melakukan sesuatu d. Mengenal perilaku baik/sopan dan buruk e. Membiasakan diri berperilaku baik f. Mengucapkan salam dan membalas salam
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
53
Sementara itu, tugas pencapaian perkembangan anak lingkup Perkembangan Nilai Agama dan Moral untuk usia 5 – 6 tahun sesuai Permendikbud Nomor 137 tahun 2014 yaitu: a. Mengucapkan salam dan membalas salam b. Mengerjakan ibadah c. Berperilaku jujur, penolong, sopan, hormat, sportif, dsb d. Menjaga kebersihan diri dan lingkungan e. Mengetahui hari besar agama f. Menghormati (toleransi) agama orang lain 2. Fisik/motorik
Perkembangan fisik anak meliputi perkembangan keterampilan motorik kasar dan motorik halus. Orang sering beranggapan bahwa perkembangan fisik anak dapat dicapai secara otomatis, artinya tidak perlu dilatih. Namun dari hasil penelitian diketahui bahwa anggapan tersebut tidak tepat, bahkan disebutkan bahwa kader/guru/orang dewasa lain perlu melatih ke anak agar anak memiliki kemampuan motorik kasar dan halus yang kuat . Tujuan perkembangan fisik anak adalah:
a. anak mampu mengendalikan gerakan kasar, yaitu menggerakan otot-otot besar tubuh, khususnya pada tangan dan kaki. Anak-anak belajar keseimbangan dan stabil/mantap, misalnya melalui lari, melompat, menendang, melempar dan menangkap
b. anak mampu mengendalikan gerakan halus, yaitu menggunakan dan mengkoordinasikan otot-otot kecil di tangan. Disini anak belajar mengembangkan keterampilan menolong diri sendiri dan memanipulasi benda-benda kecil seperti memegang gunting dan alat-alat tulis. Tugas-tugas perkembangan yang diharapkan dicapai pada aspek perkembangan fisik/motorik rentang usia 4-6 tahun sesuai dengan Permendikbud nomor 137 tahun 2014 terbagi menjadi 3 bagian utama yaitu motorik Kasar, motorik halus, dan kesehatan dan
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
54
perilaku keselamatan. Masing-masing bagian itu akan diuraikan sebagai berikut: 1. Motorik Kasar (usia 4-5 tahun) a. Menirukan gerakan binatang, pohon tertiup angin, pesawat terbang, dsb b. Melakukan gerakan menggantung (bergelayut) c. Melakukan gerakan melompat, meloncat, dan berlari secara terkoordinasi d. Melempar sesuatu secara terarah e. Menangkap sesuatu secara tepat f. Melakukan gerakan antisipasi g. Memanfaatkan alat permainan di luar kelas 2. Motorik Halus a. Membuat garis vertikal, horizontal, lengkung kiri/kanan, miring kiri/kanan, dan lingkaran b. Menjiplak bentuk c. Mengkoordinasikan mata dan tangan untuk melakukan gerakan yang rumit d. Melakukan gerakan manipulatif untuk menghasilkan suatu bentuk dengan menggunakan berbagai media e. Mengekspresikan diri dengan berkarya seni menggunakan berbagai media f. Mengontrol gerakan tangan yang meggunakan otot halus (menjumput, mengelus, mencolek, mengepal, memelintir, memilin, memeras) 3. Kesehatan dan perilaku keselamatan a. Berat badan sesuai tingkat usia b. Tinggi badan sesuai tingkat usia c. Berat badan sesuai dengan standar tinggi badan d. Lingkar kepala sesuai tingkat usia e. Menggunakan toilet (penggunaan air, membersihkan diri) dengan bantuan minimal f. Memahami berbagai alarm bahaya (kebakaran, banjir, gempa)
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
55
g. Mengenal rambu lalu lintas yang ada di jalan Sementara itu, tingkat pencapaian perkembangan anak usia 5-6 tahun untuk lingkup perkembangan fisik/motorik berdasarkan Permendikbud nomor 137 tahun 2014 akan diuraikan sebagai berikut: 1. Motorik Kasar (usia 5-6 tahun) a. Melakukan gerakan tubuh secara terkoordinasi untuk melatih kelenturan, keseimbangan, dan kelincahan b. Melakukan koordinasi gerakan mata-kaki- tangan-kepala dalam menirukan tarian atau senam c. Melakukan permainan fisik dengan aturan d. Terampil menggunakan tangan kanan dan kiri e. Melakukan kegiatan kebersihan diri 2. Motorik Halus a. Menggambar sesuai gagasannya b. Meniru Bentuk c. Melakukan eksplorasi dengan berbagai media dan kegiatan d. Menggunakan alat tulis dan alat makan dengan benar e. Menggunting sesuai dengan pola f. Menempel gambar dengan tepat g. Mengekspresikan diri melalui gerakan menggambar secara rinci 3. Kesehatan dan perilaku keselamatan a. Berat badan sesuai tingkat usia b. Tinggi badan sesuai tingkat usia c. Berat badan sesuai dengan standar tinggi badan d. Lingkar kepala sesuai tingkat usia e. Menutup hidung dan mulut (misal, ketika batuk dan bersin) f. Membersihkan, dan membereskan tempat bermain g. Mengetahui situasi yang membahayakan diri h. Memahami tata cara menyebrang i. Mengenal kebiasaan buruk bagi kesehatan (rokok, minuman keras)
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
56
3. Kognitif
Perkembangan kognitif meliputi cara anak berpikir, cara anak melihat dunianya, dan tentang cara anak menggunakan alat dan bahan main untuk belajar. Tujuan perkembangan kognitif anak adalah:
a. anak dapat belajar dan memecahkan masalah
b. anak dapat berpikir logis
c. anak dapat berpikir simbolik, yaitu anak-anak disediakan banyak pengalaman main dengan bermacam-macam mainan agar anak dapat berpindah dari berpikir konkrit ke berpikir simbolik. Tugas-tugas perkembangan yang diharapkan dicapai pada aspek perkembangan kognitif rentang usia 4-6 tahun terbagi menjadi 3 bagian utama yaitu belajar dan pemecahan masalah, berfikir logis, dan berfikir simbolik.Untuk tingkat pencapaian perkembangan anak usia 4-5 tahun akan diuraikan sebagai berikut: 1. Belajar dan Pemecahan Masalah a. Mengenal benda berdasarkan fungsi (pisau untuk memotong, pensil untuk menulis) b. Menggunakan benda-benda sebagai permainan simbolik (kursi sebagai mobil) c. Mengenal konsep sederhana dalam kehidupan sehari-hari (gerimis, hujan, gelap, terang, temaram, dsb) d. Mengetahui konsep banyak dan sedikit e. Mengkreasikan sesuatu sesuai dengan idenya sendiri yang terkait dengan berbagai pemecahan masalah f. Mengamati benda dan gejala dengan rasa ingin tahu g. Mengenal pola kegiatan dan menyadari pentingnya waktu h. Memahami posisi/kedudukan dalam keluarga, ruang, lingkungan sosial (misal: sebagai peserta didik/anak/teman) 2. Berfikir Logis a. Mengklasifikasikan benda berdasarkan fungsi, bentuk atau warna atau ukuran b. Mengenal gejala sebab-akibat yang terkait dengan dirinya
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
57
c. Mengklasifikasikan benda ke dalam kelompok yang sama atau kelompok yang sejenis atau kelompok yang berpasangan dengan 2 variasi d. Mengenal pola (misal, AB-AB dan ABC-ABC) dan mengulanginya e. Mengurutkan benda berdasarkan 5 seriasi ukuran atau warna 3. Berfikir Simbolik a. Membilang banyak benda satu sampai sepuluh b. Mengenal konsep bilangan c. Mengenal lambang bilangan d. Mengenal lambang huruf Sementara itu, tingkat pencapaian perkembangan anak usia 5-6 tahun untuk lingkup perkembangan kognitif berdasarkan Permendikbud nomor 137 tahun 2014 akan diuraikan sebagai berikut: 1. Belajar dan Pemecahan Masalah a. Menunjukkan aktivitas yang bersifat eksploratif dan menyelidik (seperti: apa yang terjadi ketika air ditumpahkan) b. Memecahkan masalah sederhana dalam kehidupan sehari-hari dengan cara yang fleksibel dan diterima sosial c. Menerapkan pengetahuan atau pengalaman dalam konteks yang baru d. Menunjukkan sikap kreatif dalam menyelesaikan masalah (ide, gagasan di luar kebiasaan) 2. Berfikir Logis a. Mengenal perbedaan ukuran: “lebih dari”; “kurang dari”; dan “paling/ter” b. Menunjukkan inisiatif dalam memilih tema permainan (seperti: “ayo kita bermain pura-pura seperti burung) c. Menyusun perencanaan kegiatan yang akan dilakukan d. Mengenal sebab-akibat tentang lingkungannya (angin bertiup menyebabkan daun bergerak, air dapat menyebabkan sesuatu menjadi basah
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
58
e. Mengklasifikasikan benda berdasarkan warna, bentuk, dan ukuran (3 variasi) f. Mengklasifikasikan benda yang lebih banyak ke dalam kelompok yang sama atau kelompok yang sejenis, atau kelompok berpasangan yang lebih dari 2 variasi g. Mengenal pola ABCD-ABCD h. Mengurutkan benda berdasarkan ukuran dari paling kecil ke paling besar atau sebaliknya 3. Berpikir Simbolik a. Menyebutkan lambang bilangan 1-10 b. Menggunakan lambang bilangan untuk menghitung c. Mencocokkan bilangan dengan lambang bilangan d. Mengenal berbagai macam lambang huruf vokal dan konsonan e. Merepresentasikan berbagai macam benda dalam bentuk gambar atau tulisan (ada benda pensil yang diikuti tulisan dan gambar pensil) 4. Bahasa
Perkembangan bahasa meliputi pemahaman dan kemampuan anak untuk mengkomunikasikan melalui ucapan dan tulisan. Tujuan perkembangan bahasa anak adalah:
a. Anak mampu mendengarkan dan berbicara, yaitu anak memahami suatu percakapan dan dapat menggunakan bahasa lisan secara tepat untuk berkomunikasi dengan orang lain.
b. Anak mampu membaca dan menulis, yaitu mempunyai pengetahuan tentang huruf-huruf (alfabet), dapat menuliskn huruf dan kata.
Tugas-tugas perkembangan yang diharapkan dicapai pada lingkup perkembangan bahasa rentang usia 4-6 tahun sesuai dengan Permendikbud Nomor 137 Tahun 2014 terbagi menjadi 3 bagian utama yaitu memahami bahasa, mengungkapkan bahasa, dan keaksaraan. Tingkat Pencapaian perkembangan
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
59
anak usia 4-5 tahun dalam lingkup perkembangan bahasa akan diuraikan sebagai berikut:
1. Menerima Bahasa
a. Menyimak perkataan orang lain (bahasa ibu atau bahasa lainnya)
b. Mengerti dua perintah yang diberikan bersamaan
c. Memahami cerita yang dibacakan
d. Mengenal perbendaharaan kata mengenai kata sifat (nakal, pelit, baik hati, berani, baik, jelek)
e. Mendengar dan membedakan bunyi-bunyian dalam Bahasa Indonesia (contoh, bunyi dan ucapan harus sama)
2. Mengungkapkan Bahasa
a. Mengulang kalimat sederhana
b. Bertanya dengan kalimat yang benar
c. Menjawab pertanyaan sesuai pertanyaan
d. Mengungkapkan perasaan dengan kata sifat (baik, senang, nakal, pelit, baik hati, berani, baik, jelek)
e. Menyebutkan kata-kata yang dikenal
f. Mengutarakan pendapat kepada orang lain
g. Menyatakan alasan terhadap sesuatu yang diinginkan atau ketidaksetujuan
h. Menceritakan kembali cerita/dongeng yang pernah didengar
i. Memperkaya perbendaharaan kata
j. Berpartisipasi dalam percakapan
3. Keaksaraan
a. Mengenal simbol-simbol
b. Mengenal suara–suara hewan/benda yang ada di sekitarnya
c. Membuat coretan yang bermakna
d. Meniru (menuliskan dan mengucapkan) huruf A-Z
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
60
Sementara itu, tingkat pencapaian perkembangan anak usia 5-6 tahun untuk lingkup perkembangan bahasa berdasarkan Permendikbud nomor 137 tahun 2014 akan diuraikan sebagai berikut: 1. Memahami Bahasa a. Mengerti beberapa perintah secara bersamaan b. Mengulang kalimat yang lebih kompleks c. Memahami aturan dalam suatu permainan d. Senang dan menghargai bacaan 2. Mengungkapkan bahasa a. Menjawab pertanyaan yang lebih kompleks b. Menyebutkan kelompok gambar yang memiliki bunyi yang sama c. Berkomunikasi secara lisan, memiliki perbendaharaan kata, serta mengenal simbol-simbol untuk persiapan membaca, menulis dan berhitung d. Menyusun kalimat sederhana dalam struktur lengkap (pokok kalimat-predikat-keterangan) e. Memiliki lebih banyak kata-kata untuk mengekpresikan ide pada orang lain f. Melanjutkan sebagian cerita/dongeng yang telah diperdengarkan g. Menunjukkan pemahaman konsep-konsep dalam buku cerita 3. Keaksaraan a. Menyebutkan simbol-simbol huruf yang dikena b. Mengenal suara huruf awal dari nama benda-benda yang ada di sekitarnya c. Menyebutkan kelompok gambar yang memiliki bunyi/huruf awal yang sama. d. Memahami hubungan antara bunyi dan bentuk huruf e. Membaca nama sendiri f. Menuliskan nama sendiri g. mahami arti kata dalam cerita.
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
61
Menurut Hurlock (1993) masa bayi dan awal masa kanak-kanak mempunyai beberapa tugas perkembangan yaitu: a. Belajar memakan makanan padat b. Belajar berjalan c. Belajar bebahasa/berbicara d. Belajar mengendalikan pembuangan kotoran tubuh e. Mempelajari perbedaan seks dan tata caranya f. Mempersiapkan diri untuk membaca g. Belajar membedakan benar dan salah, dan mulai mengembangkan hati nurani Selanjutnya ada beberapa tugas dalam belajar berbahasa pada awal masa kanak-kanak, yaitu (Hurlock, 1993): a. Pengucapan kata-kata. Anak-anak sulit belajar mengucapkan bunyi tertentu dan kombinasi bunyi, seperti huruf mati “z”, “w”, “d”, “s” dan “g” dan kombinasi huruf mati “sy”, “ng”, “kh”. Mendengarkan radio dan televisi dapat membantu belajar mengucapkan kata-kata yang benar. b. Menambah kosa kata. Kosa kata anak-anak meningkat pesat ketika ia belajar kata-kata baru dan arti-arti baru untuk kata-kata lama. Dalam menambah kosa kata anak-anak muda belajar kata-kata umum seperti “baik” dan “buruk”, “memberi” dan “menerima” dan juga banyak kata-kata dengan pengunaan khusus seperti bilangan dan nama-nama warna. c. Membentuk kalimat. Kalimat biasanya terdiri dari tiga atau empat kata sudah mulai disusun oleh anak usia dua tahun dan biasanya oleh anak usia tiga tahun. Kalimat ini banyak yang tidak lengkap terutama terdiri dari kata benda dan kurang kata kerja, kata depan dan kata penghubung. Sesudah usia tiga tahun, anak membentuk kalimat yang terdiri dari enam sampai delapan kata. 4. Sosial Emosional
Perkembangan sosial-emosi anak berkaitan dengan cara anak ketika berinteraksi dengan temannya, berinteraksi dengan
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
62
mainannya, dan berinteraksi dengan orang dewasa di lingkungannya. Lebih dari itu, perkembangan sosial emosi anak juga merupakan suatu proses dimana anak belajar tentang nilai-nilai dan perilaku yang diterima oleh masyarakat. Tujuan perkembangan sosial-emosi anak adalah:
a. Anak memiliki konsep diri yang positif, yaitu anak mengetahui tentang dirinya dan cara berinteraksi dengan orang lain
b. Anak bertanggung jawab pada dirinya dan pada orang lain, yaitu anak mau mengikuti aturan yang sudah disepakati dan kegiatan rutin yang dilakukan sehari-hari, menghormati orang lain dan berinisiatif
c. Anak berperilaku yang mendukung interaksi sosial, yaitu anak menunjukan empati, dan berinteraksi dengan dunianya melalui berbagi dan mengambil giliran.
Beberapa indikator anak yang memiliki kesiapan secara sosial dan emosi untuk masuk ke sekolah dasar adalah:
a. anak memiliki percaya diri, sikap bersahabat, dan dapat bergaul dengan temannya secara baik.
b. anak dapat berkonsentrasi dan tekun dalam melaksanakan tugas yang diberikan kader/guru/orang dewasa lain yang dekat dengan anak.
c. anak dapat mengutarakan perasaan kecewa, marah dan rasa senangnya melalui bahasa.
d. anak mau mendengarkan dan memahami perintah yang diberikan.
Tugas-tugas perkembangan yang diharapkan dicapai pada lingkup perkembangan sosial emosional rentang usia 4-6 tahun sesuai dengan Permendikbud No. 137 tahun 2014 terbagi menjadi 3 bagian utama yaitu kesadaran diri, rasa tanggung jawab untuk diri sendiri dan orang lain, serta perilaku prososial. Tingkat Pencapaian perkembangan anak usia 4-5 tahun dalam lingkup perkembangan Sosial Emosinal akan diuraikan sebagai berikut: a. Kesadaran Diri
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
63
1) Menunjukkan sikap mandiri dalam memilih kegiatan 2) Mengendalikan perasaan 3) Menunjukkan rasa percaya diri 4) Memahami peraturan dan disiplin 5) Memiliki sikap gigih (tidak mudah menyerah) 6) Bangga terhadap hasil karya sendiri b. Rasa Tanggung Jawab untuk Diri sendiri dan Orang lain 1) Menjaga diri sendiri dari lingkungannya 2) Menghargai keunggulan orang lain 3) Mau berbagi, menolong, dan membantu teman c. Perilaku Proposial 1) Menunjukan antusiasme dalam melakukan permainan kompetitif secara positif 2) Menaati aturan yang berlaku dalam suatu permainan 3) Menghargai orang lain 4) Menunjukkan rasa empati Sementara itu, tingkat pencapaian perkembangan anak usia 5-6 tahun untuk lingkup perkembangan sosial emosional berdasarkan Permendikbud nomor 137 tahun 2014 akan diuraikan sebagai berikut: a. Kesadaran Diri 1) Memperlihatkan kemampuan diri untuk menyesuaikan dengan situasi 2) Memperlihatkan kehati-hatian kepada orang yang belum dikenal (menumbuhkan kepercayaan pada orang dewasa yang tepat) 3) Mengenal perasaan sendiri dan mengelolanya secara wajar (mengendalikan diri secara wajar) b. Rasa Tanggung Jawab untuk diri sendiri dan orang lain 1) Tahu akan hak nya 2) Mentaati aturan kelas (kegiatan, aturan) 3) Mengatur diri sendiri
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
64
4) Bertanggung jawab atas perilakunya untuk kebaikan diri sendiri c. Perilaku Prososial 1) Bermain dengan teman sebaya 2) Mengetahui perasaan temannya dan merespon secara wajar 3) Berbagi dengan orang lain 4) Menghargai hak/pendapat/karya orang lain 5) Menggunakan cara yang diterima secara sosial dalam menyelesaikan masalah (menggunakan fikiran untuk menyelesaikan masalah) 6) Bersikap kooperatif dengan teman 7) Menunjukkan sikap toleran 8) Mengekspresikan emosi yang sesuai dengan kondisi yang ada (senang-sedih-antusias) 9) Mengenal tata krama dan sopan santun sesuai dengan nilai sosial budaya setempat 5. Seni
Secara konseptual pendidikan seni di TK diarahkan pada perolehan atau kompetensi hasil belajar yang beraspek pengetahuan, keterampilan dasar seni dan sikap yang berkaitan dengan kemampuan kepekaan rasa seni-keindahan serta pengembangan kreativitas. Indikasi adanya sikap keindahan ini adalah timbulnya kemampuan aktif, kreativitas anak untuk menghayati, menghargai, menyenangi kegiatan belajar seni, menyenangi karya seni dan alam lingkungan ciptaan Tuhan.
Berkaitan dengan pengembangan kemampuan seni bagi anak TK, maka pembelajaran seni merupakan sejumlah kegiatan yang dapat dilakukan oleh anak dengan lebih banyak melibatkan kemampuan motorik, khususnya motorik halus. Gerakan motorik halus mempunyai peranan yang penting dalam pengembangan seni. Motorik halus adalah gerakan yang hanya melibatkan bagian-bagian tubuh tertentu yang dilakukan oleh otot-otot kecil. Oleh karena itu, gerakan motorik halus tidak terlalu membutuhkan
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
65
tenaga, akan tetapi membutuhkan koordinasi yang cermat serta ketelitian. Tugas-tugas perkembangan yang diharapkan dicapai pada lingkup perkembangan seni rentang usia 4-6 tahun sesuai dengan Permendikbud No. 137 tahun 2014 terbagi menjadi 2 bagian utama yaitu anak mampu menikmati berbagai alunan lagu atau suara dan tertarik dengan kegiatan seni. Tingkat pencapaian perkembangan anak usia 4-5 tahun dalam lingkup perkembangan seni akan diuraikan sebagai berikut: a. Anak mampu menikmati berbagai alunan lagu atau suara 1) Senang mendengarkan berbagai macam musik atau lagu kesukaannya 2) Memainkan alat musik/instrumen/benda yang dapat membentuk irama yang teratur b. Tertarik dengan Kegiatan seni 1) Memilih jenis lagu yang disukai 2) Bernyanyi sendiri 3) Menggunakan imajinasi untuk mencerminkan perasaan dalam sebuah peran 4) Membedakan peran fantasi dan kenyataan 5) Menggunakan dialog, perilaku, dan berbagai materi dalam menceritakan suatu cerita 6) Mengekspresikan gerakan dengan irama yang bervariasi 7) Menggambar objek di sekitarnya 8) Membentuk berdasarkan objek yang dilihatnya (mis. dengan plastisin, tanah liat) Sementara itu, tingkat pencapaian perkembangan anak usia 5-6 tahun untuk lingkup perkembangan seni berdasarkan Permendikbud nomor 137 tahun 2014 akan diuraikan sebagai berikut: a. Anak mampu menikmati berbagai alunan lagu dan suara 1) Anak bersenandung atau bernyanyi sambil mengerjakan sesuatu
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
66
2) Memainkan alat musik/instrumen/benda bersama teman b. Tertarik dengan kegiatan Seni 1) Menyanyikan lagu dengan sikap yang benar 2) Menggunakan berbagai macam alat musik tradisional maupun alat musik lain untuk menirukan suatu irama atau lagu tertentu 3) Bermain drama sederhana 4) Menggambar berbagai macam bentuk yang beragam 5) Melukis dengan berbagai cara dan objek 6) Membuat karya seperti bentuk sesungguhnya dengan berbagai bahan (kertas, plastisin, balok)
D. Aktivitas Pembelajaran
Kegiatan 2
:
Tugas-tugas Perkembangan Anak TK
Media
:
1. Bahan Presentasi
2. LK02
3. Permendikbud No. 137 tahun 2014
4. Kertas Plano dan Kelengkapannya
Langkah-langkah Pembelajaran:
1. Pelatih memberikan pengantar singkat tentang tugas-tugas perkembangan anak Taman Kanak-kanak sesuai Permendikbud no. 137 tahun 2014
2. Pelatih membagi peserta menjadi 5 (lima) kelompok. Selanjutnya, secara individu setiap anggota kelompok mengerjakan LK 02 yang dilanjutkan dengan diskusi di kelompok besarnya masing-masing.
3. Kelompok memilih hasil pekerjaan salah seorang anggotanya untuk menuliskan hasilnya di kertas plano dan ditampilkan di dalam kelas mewakili kelompoknya
4. Selanjutnya pelatih mengundi kelompok yang akan tampil mempresentasikan hasil diskusinya sementara kelompok lain memberikan tanggapan
5. Pelatih memberikan penguatan.
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
67
LEMBAR KERJA 2.1 TUGAS PERKEMBANGAN ANAK TK 1. Tujuan: Peserta mampu mengidentifikasi dan mendeskripsikan perkembangan anak dilihat dari standar tingkat pencapaian perkembangan. 2. Langkah Kerja:
a. Lakukanlah pengamatan untuk mengetahui perkembangan anak TK di sekolah yang Anda bimbing sebanyak 5 orang anak sebagai sampel
b. Amatilah perilaku dan perkembangan anak di TK yang menjadi tanggung jawab Anda (minimal 5 orang anak),
c. Deskripsikanlah perilaku atau perkembangannya dilihat dari standar tingkat pencapaian perkembangan, baik untuk aspek perkembangan nilai-nilai agama dan moral, fisik/motorik, kognitif, bahasa, maupun perkembangan sosial-emosional..
d. Tuliskan data hasil pengamatan dalam tabel pengamatan yang telah disediakan
e. Presentasikanlah hasilnya oleh perwakilan kelompok di depan kelompok yang lainnya
Tabel LK 2.1 Tugas Perkembangan Anak TK
E. Latihan/Kasus/Tugas
1. Tujuan utama perkembangan nilai-nilai agama dan moral anak usia dini adalah ....
A. anak mampu membaca doa dan mengerjakan kewajiban agama. No Nama Peserta Didik Deskripsi Perkembangan
1.
dst
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
68
B. anak mampu mengenal, menirukan, dan mencontoh aktifitas keagamaan
C. anak memiliki komitmen terhadap agama yang dianutnya.
D. anak memiliki kepedulian terhadap penganut agama lain.
2. Contoh perilaku perkembangan kesehatan dan keselamatan untuk anak usia 4 - 6 tahun adalah ....
A. menutup hidung dan mulut (ketika batuk dan bersin).
B. membersihkan kotoran hidung.
C. mengelap tangan dan muka sendiri
D. mencuci atau mengganti alat makan bila jatuh
3. Kemampuan anak belajar keseimbangan dan stabil/mantap, merupakan salah bentuk perkembangan ....
A. Nilai-nilai Agama dan Moral
B. Fisik
C. Bahasa
D. Kognitif
4. Kemampuan anak mengenal sebab-akibat tentang lingkungannya, merupakan salah satu bentuk perkembangan ....
A. Nilai-nilai Agama dan Moral
B. Fisik
C. Bahasa
D. Kognitif
5. Kemampuan anak mentaati aturan yang berlaku dalam sebuah permainan, merupakan salah satu bentuk perkembangan ....
A. Sosial-emosional
B. Fisik
C. Bahasa
D. Kognitif
3
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
69
F. Rangkuman
1. Lingkup perkembangan anak usia dini sesuai dengan Permendikbud Nomor 137 Tahun 2014 mencakup lingkup perkembangan nilai-nilai agama dan moral, fisik motorik, kognitif, bahasa, sosial-emosional dan perkembangan seni.
2. Perkembangan nilai-nilai agama dan moral berkaitan dengan cara anak mengenal, menirukan, dan mencontoh berbagai aktifitas keagamaan yang dilakukan dan distimulasikan oleh orang-orang dewasa yang ada di lingkungannya serta sifat-sifat keagamaan yang menyertainya, sesuai dengan agama dan keyakinan yang dianutnya.
3. Perkembangan fisik anak meliputi perkembangan keterampilan motorikkasar, motorik halus dan kesehatan dan perilaku keselamatan.
4. Perkembangan kognitif meliputi belajar dan pemecahan masalah, berfikir logis, dan berfikir simbolik.
5. Perkembangan bahasa meliputi memahami bahasa, mengungkapkan bahasa dan keaksaraan.
6. perkembangan sosial-emosi anak berkaitan dengan cara anak ketika berinteraksi dengan temannya,berinteraksi dengan mainannya, dan berinteraksi dengan orang dewasa di lingkungannya.
7. Perkembangan sosial anak meliputi kesadaran diri, tanggung jawab diri sendiri dan orang lain, dan perilaku prososial
8. Sementara itu, perkembangan seni anak meliputi anak mampu menikmati alunan lagu atau suara dan anak tertarik dengan kegiatan seni.
9. Tugas-tugas perkembangan yang harus dipenuhi oleh anak usia 4-6 tahun diformulasikan dalam Standar Tingkat Pencapaian Perkembangan.
KP
2
PPPPTK TK DAN PLB BANDUNG
© 2016
70
G. Umpan Balik dan Tindak Lanjut
Cocokkanlah jawaban Anda dengan kunci jawaban yang terdapat di bagian akhir kegiatan pembelajaran ini. Hitunglah jawaban Anda yang benar kemudian gunakan rumus di bawah ini untuk mengetahui tingkat penguasaan Anda terhadap materi pada kegiatan pembelajaran 2. Rumus: Arti tingkat penguasaan yang anda capai: 90 – 100 % = baik sekali 80 – 90% = baik 70 – 79% = cukup < 70% = kurang
Apabila anda mencapai tingkat pencapaian penguasaaan lebih dari 80%, anda dapat melanjutkan ke kegiatan pembelajaran selanjutnya. Apabila penguasaan anda masih dibawah 80% anda harus mengulangi materi pada kegiatan pembelajaran 2 ini terutama bagian yang belum anda kuasai.
PPPPTK TK DAN PLB BANDUNG
© 2016
71
3
KOMPETENSI PROFESIONAL:
MASALAH DAN PENANGANAN
ANAK USIA DINI
PPPPTK TK DAN PLB BANDUNG
© 2016
72
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
73
KEGIATAN PEMBELAJARAN 3
DETEKSI DINI TUMBUH KEMBANG ANAK USIA DINI
A. Tujuan
Setelah mempelajari materi pokok 3 tentang Deteksi Dini Tumbuh Kembang Anak, diharapkan Anda dapat:
1. Menjelaskan hakekat deteksi tumbuh kembang anak
2. Memahami teknik deteksi dini tumbuh kembang anak
3. Memahami strategi pelaksanaan deteksi dini tumbuh kembang anak
B. Indikator Pencapaian Kompetensi
Setelah mempelajari materi pokok 3 tentang deteksi dini tumbuh kembang anak, diharapkan Anda dapat:
1. Menjelaskan pengertian dan manfaat deteksi dini tumbuh kembang anak
2. Menjelaskanteknik deteksi dini tumbuh kembang anak
3. Melaksanakan deteksi dini tumbuh kembang anak
C. Uraian Materi
1. Hakekat Deteksi DiniTumbuh Kembang Anak Usia Dini
a. Deteksi Dini dan Intervensi Tumbuh Kembang Anak usia dini
Deteksi dini tumbuh kembang anak usia dini sangat penting untuk dilakukan agar pendidik dan orang tua dapat memantau pertumbuhan dan perkembangan anak, sehingga kalau terjadi permasalahan perkembangan dan pertumbuhan pada anak dapat ditangani sejak dini supaya anak dapat tumbuh dan berkembang secara optimal. “Deteksi dini merupakan upaya penjaringan yang dilaksanakan secara komprehensif untuk menemukan penyimpangan tumbuh kembang dan mengetahui serta mengenal faktor resiko (fisik, biomedik, psikososial) terjadinya kelainan tumbuh kembang tersebut pada balita, yang disebut juga anak usia dini (Tim Dirjen Pembinaan Kesmas , 1997)”
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
74
Sedangkan intervensi adalah suatu kegiatan penanganan segera terhadapadanyapenyimpangan tumbuh kembangdengancarayangsesuaidengan keadaan misalnyaperbaikangizi,stimulasiperkembanganataumerujukkepelayanankesehatanyang sesuai,sehinggaanakdapatmencapaikemampuanyangoptimal sesuaidenganumumya. Menurut Permendikbud Nomor 146 tahun 2014, Deteksidiniadalahkegiatanuntukmenemukan secaradiniadanya potensi dan hambatanpertumbuhan danperkembangan pada anak usia dini. Sedangkan Intervensi adalah upaya khusus yang diberikan kepada anak yang menuruthasil deteksi dinidiketahui tumbuh kembangnya tidak optimal. Serangkaian upayakhusus dilakukanuntuk mengoreksi, memperbaiki, danmengatasihambatantumbuhkembangagaranakdapattumbuh dan berkembang secara optimal sesuai dengan potensinya.
b. Manfaat Deteksi Dini
Deteksi dini dilakukan untuk mengetahui penyimpangan tumbuh kembang anak secara dini, sehingga upaya pencegahan, upaya stimulasi, dan upaya penyembuhan serta pemulihan dapat diberikan dengan indikasi yang jelas sedini mungkin pada masa-masa kritis proses tumbuh kembang. Upaya-upaya tersebut diberikan sesuai dengan umur perkembangan anak, dengan demikian dapat tercapai kondisi tumbuh kembang yang optimal (Tim Dirjen Pembinaan Kesmas, 1997).
2. Teknik Deteksi Dini Tumbuh Kembang Anak usia dini
a. Teknik Deteksi dini pertumbuhan anak
Deteksidinimerupakanupayapenjaringan yang dilaksanakan secara menyeluruh untuk menemukanpenyimpangantumbuh kembang dan mengetahui serta mengenal faktor resiko pada balita, yang
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
75
disebutjuga anak usia dini. Melalui deteksi dini dapat diketahuipenyimpangantumbuh kembang anak secara dini, sehingga upaya pencegahan, stimulasi, penyembuhan serta pemulihan dapat diberikan dengan indikasi yang jelas padamasa-masakritisprosestumbuhkembang. Upaya-upaya tersebut diberikan sesuai dengan umur perkembangan anak, dengan demikian dapat tercapai kondisi tumbuh kembang yang optimal (Tim Dirjen Pembinaan Kesmas, 1997). Penilaian pertumbuhan dan perkembanganmeliputiduahalpokok,yaitupenilaian pertumbuhan fisik dan penilaian perkembangan.Masing-masingpenilaiantersebut mempunyai parameter dan alat ukur tersendiri. Deteksi tumbuh kembang anak sudah bisa dilakukan sejak anak memasuki ruang pemeriksaan bersama orang tuanya melalui observasi atau pengamatan dengan memperhatikan mulai penampilan wajah, bentuk kepala, tinggi badan hingga interaksi dengan lingkungannya. Namun demikian deteksi dini adanya gangguan sebaiknya ditempuh melalui beberapa hal, antara lain melalui anamnesis (wawancara riwayat kesehatan yang dilakukan oleh profesional/ dokter), pemeriksaan fisik dan skrining perkembangan yang sistematis agar lebih objektif. Teknik pengukuran yang dilakukan untuk mengetahui kelainan pertumbuhan anak seperti, perawakan yang pendek (short stature), perawakan tinggi (tall stature), yang diklasifikasikan sebagai variasi normal dan patologis, malnutrisi dan obesitas, adalah dengan pengukuran antropometri. Pengukuran antropometri, meliputi berat badan, tinggi badan, lingkar kepala, lingkar dada, lingkar lengan dan tebal kulit.Perlu ditekankan bahwa pengukuran antropometri hanyalah satu dari sejumlah teknik-teknik yang dapat untuk menilai pertumbuhan dan status gizi. Parameter ukuranantropometrikyangdipakai dalam penilaian pertumbuhan fisik adalah tinggi badan, berat badan, lingkar kepala,
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
76
lipatan kulit, lingkar lengan atas, panjang lengan,proporsitubuh,danpanjangtungkai.Menurut Pedoman Deteksi Dini Tumbuh KembangBalita(TimDirjenPembinaanKesmas, 1997) dan Narendra (2003) macam-macam penilaian pertumbuhan fisik yang dapat digunakan adalah:
1) Pengukuran BeratBadan (BB)
Pengukuran ini dilakukan secara teratur untuk memantau pertumbuhan dan keadaan gizi balita. Balita ditimbang setiap bulan dan dicatat dalam Kartu Menuju Sehat Balita (KMS Balita) sehingga dapat dilihat grafik pertumbuhannya dan dilakukan intervensi jika terjadi penyimpangan. Pengukuran terhadap berat badan bertujuan untuk menentukan statusgizianak,normal,kurus,kurussekaliataugemuk. Adapun jadwal pengukuran Berat badandapatdisesuaikan dengan jadwalDeteksi Dini Tumbuh Kembang.Pengukuran dan penilaian berat badandapatdilakukan olehtenaga kesehatan terlatih, yaitu tenaga kesehatan yang telahmengikutipelatihantentang deteksi tumbuh kembang anak
2) Pengukuran Tinggi Badan (TB)
Pengukurantinggibadanpadaanak sampai usia 2 tahun dilakukan dengan berbaring,sedangkandiatasumur 2 tahun dilakukan dengan berdiri. Hasil pengukuran setiap bulandapatdicatatpada KMS yang mempunyai grafik pertumbuhan tinggi badan.
3) PengukuranLingkarKepalaAnak(LKA)
PLKA adalah cara yang biasa dipakai untuk mengetahui pertumbuhan dan perkembanganotakanak.Biasanya ukuran pertumbuhan tengkorak mengikuti perkembanganotak,sehinggabilaadahambatan pada pertumbuhan tengkorak makaperkembanganotak anak juga terhambat. Pengukuran dilakukan pada diameter occipitofrontal dengan mengambil rerata 3 kali pengukuran sebagai standar. Tujuan pengukuran LKA adalah untuk mengetahui lingkaran kepalaanakdalambatasnormalataudiluarbatasnormal
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
77
Deteksi dini penyimpangan pertumbuhan dilakukan di semua tingkat pelayanan. Adapun pelaksana dan alat yang digunakan dapatdilihatpadatable3.1.
Tabel 3 1. Pelaksanaan dan Alat yang Digunakan Untuk Deteksi Dini Penyimpangan Pertumbuhan
Tingkat Pelayanan
Pelaksana
AlatyangDigunakan
Keluarga, masyarakat
• Orangtua • Kaderkesehatan •PetugasPAUD,BKB,TPAdanGuruTK
• KMS • Timbangan dacin
Puskesmas
• Dokter • Bidan • Perawat • Ahligizi • Petugaslain
• TableBB/TB • GrafikLK • Timbangan • Alatukurtinggi badan • Pita pengukur lingkarkepala
Sumber:BukuPedomanPelaksanaanSDIDTK
b. Teknik Deteksi dini perkembangan anak
Perkembangan adalah bertambahnya kemampuan atau fungsi semua sistem organ tubuh sebagai akibat bertambahnya kematangan fungsi-fungsi sistem organ tubuh. Perkembangan anak tidak hanya di tentukan oleh faktor genetik (nature) atau dianggap sebagai produk lingkungan (nurture) saja. Model biopsikososial pada tumbuh kembang anak mengakui pentingnya pengaruh kekuatan intrinsik dan ekstrinsik. Tinggi badan misalnya adalah fungsi antara faktor genetik (biologik), kebiasaan makan (psikologik) dan terpenuhinya makanan bergizi (sosial) pada anak. Deteksi dini terhadap perkembangan anak dilakukan melalui teknik skrining perkembangan adalah prosedur yang relatif cepat, sederhana dan murah bagi anak-anak yang tanpa gejala namun mempunyai resiko tinggi atau dicurigai mempunyai masalah. Bayi atau anak
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
78
dengan resiko tinggi berdasarkan anamnesis dan pemeriksaan fisik rutin harus dilakukan skrining secara periodik. Bayi atau anak dengan resiko rendah dimulai dengan pertanyaan pra-skrining yang diisi atau dijawab oleh orang tua. Apabila ada kecurigaan dalam tumbuh kembang yang dijawab oleh orang tua balita, baru dilanjutkan dengan skrining. Peralatanskrining perkembangan, terdiri dari beberapa perangkat, diantaranya: 1). Kuesioner Pra Skrining Perkembangan (KPSP) KPSP adalah suatu daftar pertanyaan singkat yang ditujukan kepada orang tua dan dipergunakan sebagai alat untuk melakukan skrining pendahuluan perkembangan anak usia 3 bulan sampai dengan 6 tahun. Untuk tiap golongan usia terdapat 10 pertanyaan untuk orang tua atau pengasuh. Tujuan pemeriksaan perkembangan menggunakan KPSP adalah untuk mengetahui perkembangan anak normal atau ada penyimpangan. KPSP dapat digunakan untuk mengetahui ada tidaknya hambatan dalam perkembangan anak. Namun hasil yang negatif tidak selalu berarti bahwa perkembangan anak tersebut tidak normal, tetapi hal ini menunjukkan bahwa anak tersebut memerlukan pemeriksaan lebih lanjut. Untuk jumlah jawaban “Ya” kurang atau sama dengan enam, maka anak tersebut harus dirujuk ke ahli. 2). Kuesioner Perilaku Anak Prasekolah (KPAP) KPAP adalah sekumpulan kondisi-kondisi perilaku yang digunakan sebagai alat untuk mendeteksi secara dini kelainan-kelainan perilaku anak prasekolah, sehingga dapat segera dilakukan tindakan untuk mengantisipasinya. KPAP diberikan kepada anak usia prasekolah atau 3-6 tahun. Dalam KPAP terdapat 30 perilaku yang ditanyakan kepada orang tua atau pengasuh anak. Jika didapatkan hasil nilai lebih atau sama dengan sebelas, maka anak perlu dirujuk.
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
79
3). Tes Daya Lihat (TDL) bagi Anak Prasekolah Tes daya lihat adalah tes yang dilakukan untuk mendeteksi secara dini adanya kelainan penglihatan pada anakagar segera dapat dilakukan tindakan intervensi sehingga kesempatan untuk memperoleh ketajaman penglihatan menjadi lebih besar. 4). TesDayaDengar(TDD) Tes dayadengaradalah tes yang dilakukan untukmenemukangangguan pendengaran sejak dini, agar dapat segera ditindaklanjuti untuk meningkatkan kemampuan daya dengar dan bicara anak. Deteksiterhadap perkembangan anakinidilakukan disemuatingkatpelayanan. Pelaksana dan alatyangdigunakandapatdilihatpadatabel3.3.
Tabel 3 2. Pelaksana dan Alat yang digunakan Untuk Deteksi Dini Penyimpangan Perkembangan Anak
Tingkat Pelayanan
Pelaksana
AlatyangDigunakan
Keluarga dan Masyarakat
• Orangtua • Kader kesehatan, BKB, TPA
BukuKIA
• Petugas pusat PAUDterlatih • GuruTKterlatih
• KPSP • TDL • TDD
Puskesmas
• Dokter • Bidan • Perawat
• KPSP • TDL • TDD
Sumber:BukuPedomanPelaksanaanSDIDTK Keterangan: BukuKIA :BukuKesehatanbudanAnak KPSP :KuesionerPraSkriningPerkembangan TDL :TesDayaLihat TDD :TesDayaDengar BKB :BinaKeluargaBalita TPA :TempatPenitipanAnak PusatPAUD :PusatPendidikanAnakUsiaDini TK :TamanKanak-kanak
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
80
c. Teknik Deteksi dini Penyimpangan Mental emosional
Deteksidini penyimpanganmentalemosionaladalah kegiatan/pemeriksaanuntuk menemukangangguansecaradini adanyamasalahemosional, autism dan gangguanpemusatan perhatian dan hiperaktivitas pada anak, agar dapat segera dilakukan tindakan intervensi. Bila penyimpangan mental emosionalterlambatdiketahuimakaintervensinyaakanlebihsulit dan hal ini akan berpengaruh pada tumbuh kembang anak. Deteksiinidilakukanolehtenagakesehatan. Deteksi dini penyimpangan mental emosional dapat dilakukan dengan menggunakan Kuesioner, diantaranya kuesioner Masalah Mental Emosional, Checlist of Autisim in Todlers, Gangguan Pemusatan Perhatian dan Hiperaktivitas.
3. Strategi Pelaksanaan Deteksi Dini Tumbuh Kembang Anak
Deteksi tumbuh kembang anak adalah kegiatan atau pemeriksaan untuk menemukan secara dini adanya penyimpangan tumbuh kembang pada balita dan anak prasekolah. Dengan ditemukan penyimpangan atau masalah tumbuh kembang anak secara dini, maka intervensi akan lebih mudah dilakukan. Tenaga kesehatan juga akan mempunyai waktu dalam membuat rencana tindakan atau intervensi yang tepat. Terutama ketika harus melibatkan ibu/ keluarga. Secara umum terdapat tiga jenis deteksi dini tumbuh kembang, yakni sebagai berikut.
a. Deteksi dini penyimpangan pertumbuhan, yaitu untuk mengetahui/menemukan status gizi kurang/buruk dan mikro/makrosefali.
b. Deteksi dini penyimpangan perkembangan, yaitu untuk mengetahui gangguan perkembangananak (keterlambatan daya lihat, dan gangguan daya dengar).
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
81
c. Deteksi dini penyimpangan mental emosional, yaitu untuk mengetahui adanya masalah mental emosional, seperti autism, dan gangguan pemusatan perhatian, serta hiperaktifitas.
Berikut ini akan dijelaskan bagaimana strategi pelaksanaan tiga jenis deteksi untuk mengetahui adanya penyimpangan baik pertumbuhan, perkembangan maupun mental emosional anak usia dini
a. Strategi Pelaksanaan Deteksi Dini Pertumbuhan anak
Pertumbuhan berkaitan dengan masalah perubahan dalam hal besar, jumlah ukuran, atau dimensi, baik pada tingkat sel, organ, maupun individu.Deteksi dini penyimpangan pertumbuhan dilakukan di semua tingkat pelayanan. Pelaksanaan deteksi dini pertumbuhan anak, dimulai dengan melakukan pengukuran terhadap berat badan (BB), tinggi badan (TB), dan lingkar kepala anak (LKA), untuk mengetahui apakah pertumbuhan anak itu masih normal atau di luar batas normal.
(1) Pengukuran berat badan terhadap tinggi badan.
Tujuan pengukuran BB/TB adalah untuk menentukan status gizi anak, apakah anak yang dimaksud normal, kurus, kurus sekali, atau gemuk. Jadwal pengukuran BB/TB disesuaikan dengan jadwal deteksi dini tumbuh kembang balita.
a) Pengukuran berat badan (BB) Menggunakan timbangan injak pada anak
1) Letakkan timbangan di lantai yang datar sehingga tidak mudah bergerak
2) Lihat posisi jarum atau angka menunjuk angka nol Anak sebaiknya memakai baju sehari-hari yang tipis, tidak memakai alas kaki, jaket, topi, jam tangan, kalung dan tidak memegang sesuatu
3) Anak berdiri di atas timbangan tanpa dipegangi Lihat jarum timbangan sampai berhenti
4) Baca angka yang ditunjukkan oleh jarum timbangan atau angka timbangan
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
82
5) Bila bayi terus bergerak, perhatikan gerakan jarum, baca angka di tengah-tengah antara gerakan jarum ke kanan dan ke kiri.
b) Pengukuran panjang badan (PB)/ tinggi badan (TB).
Untuk pengukuran panjang badan atautinggi badan, petugasharus memiliki keterampilan mengukur panjang badan dengan posisiberbaring sertamengukur tinggibadan dengan posisi berdiri. Cara mengukur dengan posisi berbaring
1) Sebaiknya pengukuran dilakukan oleh 2 orang.
2) Bayi dibaringkan telentang pada alas yang datar dengan posisi. Kepala bayi menempel pada pembatas angka nol.
3) Petugas 1: kedua tangan memegang kepala bayi agar tetap menempel pada pembatas angka nol (pembatas kepala)
4) Petugas 2: tangan kiri menekan lutut bayi agar lurus, tangan kanan menekan batas kaki ke telapak kaki
5) Petugas 2: membaca angka di tepi luar pengukur Cara mengukur dengan posisi berdiri
1) Anak tidak memakai sandal atau sepatu
2) Berdiri tegak menghadap ke depan
3) Punggung, pantat dan tumit menempel pada tiang pengukur
4) Turunkan batas atas pengukur sampai menempel di ubun-ubun
5) Baca angka pada batas tersebut
c) Penggunaan tabel BB/TB (direktorat gizi masyarakat, 2002)
1) Ukur tinggi atau panjang dan timbang berat badan anak, sesuai dengan cara di atas
2) Lihat kolom tinggi atau panjang badan anak yang sesuai dengan hasil pengukuran
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
83
3) Pilih kolom berat badan untuk laki-laki (kiri) atau perempuan (kanan) sesuai jenis kelamin anak, cari angka berat badan yang terdekat dengan berat badan anak
4) Dari angka berat badan tersebut, lihat bagian atas kolom untuk mengetahui angka Standar Deviasi (SD)
(2) Pengukuran Lingkar kepala anak.
a) Tujuan pengukuran lingkarkepala adalah untuk mengetahui lingkarkepala anak apakah berada dalam batas normal atau diluar batas normal.
b) Jadwal pengukuran Lingkar kepala disesuaikan dengan usia anak. Untuk anak berusia 0-11 bulan pengukuran dilakukan setiap 3 bulan, dan untuk anak berusia12-72 bulan pengukuran dilakukan setiap 6 bulan.
c) Cara mengukur lingkar kepala
1) Lingkarkan meteran untuk mengukur kepala melewatidahi, menutupi alis mata, di atas kedua telinga, dan bagian belakang kepala yang menonjol, lalu tarik agak kencang.
2) Baca angka pada pertemuan dengan angka 0
3) Tanyakan tanggal lahir bayi/anak, hitungusiabayi/ anak
4) Hasil pengukuran dihitung pada grafiklingkar kepalamenurut umur dan jenis kelamin anak
5) Buat garis yang menghubungkan antara ukuran yang lalu dengan ukuran yang sekarang
d) Interpretasi.
1) Bila ukuran lingkar kepala anak berada di dalam jalur hijau maka lingkar kepala anak normal
2) Bila ukuran lingkar kepala anak berada di luar jalur hijau, maka lingkar kepala anak tidak normal
3) Lingkar kepala anak yang tidak normal dibedakan menjadi 2: makrosepal, bila berada di atas jalur hijau dan mikrosepal, bila berada dibawah jalur hijau
e) Intervensi Bila ditemukan makrosepal maupun mikrosepal segera dirujuk ke Rumah Sakit
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
84
b. Strategi pelaksanaan Deteksi dini perkembangan anak
a. Strategi pelaksanaan deteksi perkembangan anak menggunakan kuesioner pra skrining perkembangan (KPSP) Skrining perkembangan dengan menggunakan kuesioner pra skrining perkembangan (KPSP)dapat dilaksanakan dengan langkah-langkah sebagai berikut: a) Tujuan: untuk mengetahui perkembangan anak normal atau ada penyimpangan b) Jadwal skrining: umur 3, 6, 9, 12, 15, 18, 21, 24, 30, 36, 42, 48, 54, 60, 66, 72bulan. Jika anak belum mencapai umur skrining tersebut, minta ibu datang kembali pada umur skrining yang terdekat untuk pemeriksaan rutin. c) Skrining dilakukan oleh tenaga kesehatan, guru TK, petugas PAUD terlatih. d) Alat yang digunakan adalah Formulir KPSP menurut umur. Formuir ini berisi 9- 10 pertanyaan tentang kemampuan perkembangan yang telah dicapai anak. Sasaran KPSP anak umur 0- 72 bulan. Alat bantu pemeriksaan berupa: pensil, kertas, bola sebesar bola tenis, kericingan, kubus berukuran 2, 5 cm sebanyak 6 buah, kismis, kacang tanah, potongan biscuit kecil berukuran 0, 5 - 1 cm e). Cara menggunakan KPSP Pada waktu pemeriksaan anak harus dibawa. Tentukan umur anak dengan menanyakan tanggal, bulan dan tahun anak lahir. Bila umur anak lebih dari 16 hari dibulatkan menjadi 1 bulan. Setelah menentukan umur anak, pilih pilih KPSP yang sesuai umur anak KPSP terdiri atas 2 macam pertanyaan, yaitu: (1) Pertanyaan yang dijawab oleh ibu atau pengasuh anak. (2) Perintah kepada ibu atau pengasuh anak atau petugas untuk melaksanakan tugas yang tertulis pada KPSP.
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
85
Jelaskan kepada orang tua agar tidak ragu-ragu atau takut menjawab oleh karena itu tanyakan pertanyaan tersebutsecara berurutan satu persatu. Setiap pertanyaan hanya satu jawaban ya atau tidak. Catat jawaban tersebut pada formulir. Ajukan pertanyaan yang berikutnya setelah ibu/pengasuh anak menjawab pertanyaan terdahulu. Teliti kembali apakah semua pertanyaan telah dijawab f). Interpretasi hasil KPSP Hitung berapa jumlah jawaban “ya”. Jawaban “ya”, bila ibu atau pengasuh anak menjawab: anak bisa atau anak pernah atau anak sering atau kadang-kadang. Jawaban “tidak”, bila ibu/ pengasuh anak menjawab: anak belum pernah melakukan atau tidak pernah atau ibu/ pengasuh anak tidak tahu. Jumlah jawaban “ya”= 9 atau 10, perkembangan anak sesuai tahap perkembangannya (S). Jumlah jawaban “ya”= 7 atau 8, perkembangan anak meragukan (M). Jumlah jawaban “ya”=6 atau kurang, kemungkinan ada penyimpanan (P). Untuk jawaban “tidak”, perlu dirinci jumlah jawaban “tidak” menurut jenis keterlambatan (gerak kasar, gerak halus, bicara dan bahasa, sosialisasi dan kemandirian). g). Intervensi Bila perkembangan anaksesuai umur atau (S), lakukan tindakan sebagai berikut: Beri pujian kepada ibu karena telah mengasuh anaknya dengan baik. Teruskan pola asuh anak sesuai tahap perkembangan anak. Beri stimulasi perkembangan anak setiap saat, sesering, sesuai dengan umur dan kesiapan anak.
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
86
Ikutkan anak pada kegiatan penimbangan dan pelayanan kesehatan di posyandu secara teratur sebulan sekali dan setiap ada kegiatan Bina Keluarga Balita. Jika anak sudah memasuki usia prasekolah (36- 72 bulan), anak dapat diikutkan pada kegiatan di PAUD, kelompok bermain dan TK Lakukan pemeriksaan rutin menggunakan KPSP setap 3 bulan pada berumur kurang dari umur 24 bulan dan setiap 6 bulan pada umur 24 bulan sampai 72 bulan. Bila perkembangan anak meragukan (M), lakukan tindakan berikut: Beri petunjuk kepada ibu agar melakukan stimulasi perkembangan pada anak lebih sering lagi, setiap saat dan sesering mungkin. Ajarkan ibu cara melakukan intervensi stimulasi perkembangan anak untuk mengatasi penyimpanan/ mengejar ketinggalannya. Lakukan pemeriksaan kesehatan untuk mencari kemungkinan adanya penyakit yang menyebabkan penyimpangan/ mengejar ketinggalannya. Lakukan pemeriksaan kesehatan untuk mencari kemungkinan adanya penyakit yang menyebabkan penyimpangan perkembangannya. Lakukan penilaian ulang KPSP 2 minggu kemudian dengan menggunakan daftar KPSP yang sesuai dengan umur anak. Jika hasil KPSP ulang jawabannya “ya” tetap 7 atau 8 maka kemungkinan ada penyimpangan (P). Bila tahapan perkembangan terjadi penyimpangan (P), lakukan tindakan sbb: Rujuk ke RS, dengan menuliskan jenis dan jumlah penyimpangan perkembangan (gerak kasar, gerak halus, bicara, bahasa, sosialisasi dan kemanidirian) h). Contoh Kuesioner Praskrining
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
87
Kuesioner Praskrining untuk Anak 48 bulan
a) Dapatkah anak mengayuh sepeda roda tiga sejauh sedikitnya 3 meter?
b) Setelah makan, apakah anak mencuci dan mengeringkan tangannya dengan baik sehingga anda tidak perlu mengulanginya?
c) Suruh anak berdiri satu kaki tanpa berpegangan. Jika perlu tunjukkan caranya dan beri anak anda kesempatan melakukannya 3 kali. Dapatkah ia mempertahankan keseimbangan dalam waktu 2 detik atau lebih?
d) Letakkan selembar kertas seukuran buku ini di lantai. Apakah anak dapat melompati panjang kertas ini dengan mengangkat kedua kakinya secara bersamaan tanpa didahului lari?
e) Jangan membantu anak dan jangan menyebut lingkaran. Suruh anak menggambar seperti contoh ini di kertas kosong yang tersedia. Dapatkah anak menggambar lingkaran?
f) Dapatkah anak meletakkan 8 buah kubus satu persatu di atas yang lain tanpa menjatuhkan kubus tersebut? Kubus yang digunakan ukuran 2.5 – 5 cm.
g) Apakah anak dapat bermain petak umpet, ular naga atau permainan lain dimana ia ikut bermain dan mengikuti aturan bermain?
h) Dapatkah anak mengenakan celana panjang, kemeja, baju atau kaos kaki tanpa di bantu? (Tidak termasuk memasang kancing, gesper atau ikat pinggang)
i) Dapatkah anak menyebutkan nama lengkapnya tanpa dibantu? Jawab TIDAK jika ia hanya menyebutkan sebagian namanya atau ucapannya sulit dimengerti.
Kuesioner Praskrining untuk Anak 60 bulan
a) Isi titik-titik di bawah ini dengan jawaban anak. Jangan membantu kecuali mengulangi pertanyaan. “Apa yang kamu lakukan jika kamu kedinginan?” “Apa yang kamu lakukan jika kamu lapar?” “Apa yang kamu lakukan jika kamu lelah?”
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
88
Jawab YA biia anak mnrjawab ke 3 pertanyaan tadi dengan benar, bukan dengan gerakan atau isyarat. Jika kedinginan, jawaban yang benar adalah “menggigil”,”pakai mantel‟ atau “masuk kedalam rumah‟. Jika lapar, jawaban yang benar adalah “makan” Jika lelah, jawaban yang benar adalah “mengantuk”, “tidur”, “berbaring/tidur-tiduran”, “istirahat” atau “diam sejenak”
b) Apakah anak dapat mengancingkan bajunya atau pakaian boneka?
c) Suruh anak berdiri satu kaki tanpa berpegangan. Jika perlu tunjukkan caranya dan beri anak ands kesempatan melakukannya 3 kali. Dapatkah ia mempertahankan keseimbangan dalam waktu 6 detik atau lebih?
d) Jangan mengoreksi/membantu anak. Jangan menyebut kata “lebih panjang”. Perlihatkan gambar kedua garis ini pada anak. Tanyakan: “Mana garis yang lebih panjang?” Minta anak menunjuk garis yang lebih panjang. Setelah anak menunjuk, putar lembar ini dan ulangi pertanyaan tersebut. Setelah anak menunjuk, putar lembar ini lagi dan ulangi pertanyaan tadi. Apakah anak dapat menunjuk garis yang lebih panjang sebanyak 3 kali dengan benar?
e) Jangan membantu anak dan jangan memberitahu nama gambar ini, suruh anak menggambar seperti contoh ini di kertas kosong yang tersedia. Berikan 3 kali kesempatan. Apakah anak dapat menggambar seperti contoh ini?
f) Ikuti perintah ini dengan seksama. Jangan memberi isyarat dengan telunjuk atau mats pads saat memberikan perintah berikut ini: “Letakkan kertas ini di atas lantai”. “Letakkan kertas ini di bawah kursi”. “Letakkan kertas ini di depan kamu” “Letakkan kertas ini di belakang kamu”
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
89
Jawab YA hanya jika anak mengerti arti “di atas”, “di bawah”, “di depan” dan “di belakang”
g) Apakah anak bereaksi dengan tenang dan tidak rewel (tanpa menangis atau menggelayut pada anda) pada saat anda meninqgalkannya?
h) Jangan menunjuk, membantu atau membetulkan, katakan pada anak : “Tunjukkan segi empat merah” “Tunjukkan segi empat kuning” „Tunjukkan segi empat biru” “Tunjukkan segi empat hijau” Dapatkah anak menunjuk keempat warna itu dengan benar?
i) Suruh anak melompat dengan satu kaki beberapa kali tanpa berpegangan (lompatan dengan dua kaki tidak ikut dinilai). Apakah ia dapat melompat 2-3 kali dengan satu kaki?
j) Dapatkah anak sepenuhnya berpakaian sendiri tanpa bantuan?
Kuesioner Praskrining untuk Anak 72 bulan
a) Jangan menunjuk, membantu atau membetulkan, katakan pada anak : “Tunjukkan segi empat merah” “Tunjukkan segi empat kuning” “Tunjukkan segi empat biru” “Tunjukkan segi empat hijau” Dapatkah anak menunjuk keempat warna itu dengan benar?
b) Suruh anak melompat dengan satu kaki beberapa kali tanpa berpegangan (lompatan dengan dua kaki tidak ikut dinilai). Apakah ia dapat melompat 2-3 kali dengan satu kaki?
c) Dapatkah anak sepenuhnya berpakaian sendiri tanpa bantuan?
d) Suruh anak menggambar di tempat kosong yang tersedia. Katakan padanya: "Buatlah gambar orang". Jangan memberi perintah lebih dari itu. Jangan bertanya/ mengingatkan anak bila ada bagian yang belum tergambar. Dalam memberi nilai, hitunglah berapa bagian tubuh yang
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
90
tergambar. Untuk bagian tubuh yang berpasangan seperti mata, telinga, lengan dan kaki, setiap pasang dinilai satu bagian. Dapatkah anak menggambar sedikitnya 3 bagian tubuh?
e) Pada gambar orang yang dibuat pada nomor 7, dapatkah anak menggambar sedikitnya 6 bagian tubuh?
f) Tulis apa yang dikatakan anak pada kalimat-kalimat yang belum selesai ini, jangan membantu kecuali mengulang pertanyaan: "Jika kuda besar maka tikus "Jika api panas maka es "Jika ibu seorang wanita maka ayah seorang Apakah anak menjawab dengan benar (tikus kecil, es dingin, ayah seorang pria)?
g) Apakah anak dapat menangkap bola kecil sebesar bola tenis/bola kasti hanya dengan menggunakan kedua tangannya? (Bola besar tidak ikut dinilai).
h) Suruh anak berdiri satu kaki tanpa berpegangan. Jika perlu tunjukkan caranya clan beri anak anda kesempatan melakukannya 3 kali. Dapatkah ia mempertahankan keseimbangan dalam waktu 11 detik atau lebih?
i) Jangan membantu anak dan jangan memberitahu nama gambar ini, Suruh anak menggambar seperti contoh ini di kertas kosong yang tersedia. Berikan 3 kali kesempatan. Apakah anak dapat menggambar seperti contoh ini?
j) lsi titik-titik di bawah ini dengan jawaban anak. Jangan membantu kecuali mengulangi pertanyaan sampai 3 kali bila anak menanyakannya. "Sendok dibuat dari apa?" "Sepatu dibuat dari apa?" "Pintu dibuat dari apa?" Apakah anak dapat menjawab ke 3 pertanyaan di atas dengan benar? Sendok dibuat dari besi, baja, plastik, kayu.
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
91
Sepatu dibuat dari kulit, karet, kain, plastik, kayu. Pintu dibuat dari kayu, besi, kaca.
4. Strategi Pelaksanaan Deteksi Dengan Tes Daya Dengar (TDD) Pelaksanaan pengukuran perkembangan anak melalui tes daya dengar (TDD) dapat dilaksanakan dengan langkah-langkah sebagai berikut: 1. Tujuan: untuk menemukan gangguan pendengaran sejak dini, agar dapat segera ditindak lanjuti untuk meningkatkan kemampuan daya dengar dan bicara anak. 2. Jadwal: setiap 3 bulan pada bayi kurang dari 12 bulan dan setiap 6 bulan pada anak usia 12 bulan ke atas. Tes ini dilakukan oleh tenaga kesehatan, guru TK, tenaga PAUD, dan petugas terlatih lainnya. 3. Alat yang diperlukan: Instrument TDD menurut umur anak Gambar binatang (ayam, anjing, kucing) dan manusia Mainan (boneka, kubus, sendok, cangkir, dan bola) 4. Cara melakukan TDD: tanyakan tanggal, bulan dan tahun anak lahir, hitung umur anak dalam bulan, pilih daftar pertanyaan TDD yang sesuai dengan umur anak Pada anak umur kurang dari 24 bulan: Semua pertanyaan harus dijawab oleh orang tua/ pengasuh anak. Tidak usah ragu-ragu atau takut menjawab karena tidak untuk mencari siapa yang salah. Bacakan pertanyaan dengan lambat, jelas dan nyaring, satu persatu dan berurutan. Tunggu jawaban dari orang tua atau pengasuh anak. Jawaban “ya” jika menurut orang tua/ pengasuh, anak dapat melakukannya dalam 1 bulan terakhir. Pada anak umur 24 bulan atau lebih: Pertanyaan-pertanyaan berupa perintah melalui orang tua/pengasuh untuk dikerjakan oleh anak. Amati kemampuan aank dalam melakukan perintah orang tuan atau pengasuh.
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
92
Jawaban “ya” jika anak dapat melakukan perintah orang tua/ pengasuh. Jawaban „tidak” jika anak tidak dapat atau tidak mau melakukan perintah orang tua/ pengasuh. 5. Interpretasi Bila ada satu atau lebih jawaban “tidak”, kemungkinan anak mengalami gangguan pendengaran. Catat dalam buku KIA atau kartu kohort bayi/ balita/ status/ catatan medik anak jenis kelainan 6. Intervensi: Tindak lanjut sesuai dengan buku pedoman yang ada Rujuk ke RS bila tidak dapat ditanggulangi
5. Strategi Pelaksanaan Deteksi Perkembangan Anak Dengan Tes Daya Lihat (TDL) Untuk melakukan pengukuran perkembangan anak melalui tes daya lihat (TDL) terlebih dahulu kita harus membuat langkah-langkah sebagai berikut: a) Tujuan: untuk mendeteksi secara dini kelainan dapat dilihat agar segera dapat dilakukan tindakan lanjutan sehingga kesempatan untuk memperoleh ketajaman daya lihat menjadi lebih besar. b) Jadwal: dilakukan setiap 6 bulan pada anak usia prasekolah umur 36-72 bulan. Tes ini oleh tenaga kesehatan, guru TK, petugas PAUD terlatih. c) Alat yang diperlukan: Ruangan yang bersih, tenang dengan penyinaran yang baik. Dua buah kursi, satu untuk anak, satu untuk pemeriksa. Poster “E” untuk digantung dari kartu “E” untuk dipegang anak. Alat penunjuk
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
93
Gambar 3. 1 Tes Daya Lihat https://www.google.co.id/search?newwindow=1&client=ms-android- d) Cara melakukan tes daya lihat Pilih suatu ruang bersih dan tenang dengan penyinaran yang baik. Gantungkan poster “E” setinggi mata anak pada posisi duduk. Letakkan sebuat kursi sejauh 3 meter dari poster “E” menghadap ke poster “E”. Letakkan sebuah kursi lainnya disamping poster “E” untuk pemeriksa. Pemeriksa memberikan kartu “E” pada anak. Latih anak dalam mengarahkan kartu E menghadap ke atas, bawah, kiri, kanan, sesuai ditunjuk pada poster “E” oleh pemeriksa, beri pujian setiap kali anak mau melakukannya. Lakukan hal ini sampai anak dapat mengarahkan kartu “E” dengan benar. Selanjutnya anak diminta menutup sebelah matanya dengan buku/ kertas Dengan alat penunjuk, tunjuk huruf “E” pada poster satu- persatu mulai garis pertama sampai garis ke empat atau garis “E” terkecil yang masih dapat dilihat. Uji anak setiap kali dapat mencocokan posisi kartu “E” yang dipegangnya dengan huruf “E” pada poster. Ulangi pemeriksaan tersebut pada mata satunya dengan cara yang sama.
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
94
Tulis baris “E” terkecil yang masih dapat dilihat pada kertas yang telah disediakan . Mata kanan:………………………… mata kiri:…………………….. e) Interpretasi Anak prasekolah umumnya tidak mengalami kesulitan sampai baris ke-3 pada poster “E” bila kedua mata anak tidak dapat melihat garis ke-3 poster “E” artinya tidak dapat mencocokan arah kartu “E” yang dipegangnya dengan arah “E” pada baris ke-3 yang ditunjuk oleh pemeriksa, kemungkinan anak mengalami gangguan daya lihat. f) Intervensi Bila kemungkinan mengalami gangguan daya lihat, minta anak datang lagi untuk pemeriksaan ulang. Bila pada pemeriksaan berikutnya, anak tidak dapat melihat sampai baris yang sama atau tidak dapat melihat garis yang sama dengan kedua matanya, rujuk ke RS dengan menuliskan mata yang yang mengalami gangguan (kanan, kiri, atau keduanya).
6. Strategi Pelaksanaan Deteksi Perkembangan Mental Emosional Deteksi dini penyimpangan mental emosional adalah kegiatan atau pemeriksaan untuk menemukan secara dini adanya masalah mental emosional,autisme dan gangguan pemusatan perhatian dan hiperaktivitas pada anak (GPPH),agar dapat segera dilakukan tindakan intervensi. Alat yang digunakan untuk mendeteksi yaitu: a. Kuesioner masalah mental emosional (KMME) Bagi anak umur 36-72 bulan b. Ceklis autis anak pra sekolah (Checklist for Autism in Toddlers CHAT) bagi anak umur 18-36 bulan c. Formulir deteksi dini Gangguan Pemusatan Perhatiaan dan Hiperaktivitas (GPPH) yang menggunakan Abreviated Conner Ratting Scale Bagi anak umur 36 bulan keatas.
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
95
Berikut ini teknik pelaksanaan penggunaan kuesioner untuk mendeteksi penyimpangan mental emosional pada anak usia dini: a. Deteksi dini masalah mental emosional pada anak prasekolah langkah-langkah kegiatan: 1). Tujuan: untuk mendeteksi secara dini adanya penyimpangan atau masalah mental emosional pada anak prasekolah 2). Jadwal deteksi dini masalah mental emosional adalah rutin setiap 6 bulan pada anak umur 36-72 bulan. Jadwal ini sesuai dengan jadwal skrining atau pemeriksaan perkembangan anak. 3). Alat yang digunakan adalah KMME yang terdiri dari 12 pertanyaan untuk mengenali problem mental emosional anak umur 36-72 bulan. 4). Cara kerja: Tanyakan setiap pertanyaan dengan lambat,jelas dan nyaring satu persatu perilaku yang tertulis pada KMME Kepada orang tua atau pengasuh anak. Catat jawaban “Ya”, kemudian hitung jumlah jawaban “YA” 5). Interpretasi Bila ada jawaban “YA”, maka kemungkinan anak mengalami masalah mental emosional. 6). Intervensi Bila jawaban “ya” hanya 1 : Lakukan konseling kepada orang tua menggunakan Buku Pedoman Pola Asuh yang mendukung Perkembangan Anak Lakukan evaluasi setelah 3 bulan, bila tidak ada perubahan rujuk ke Rumah Sakit yang memiliki fasilitas kesehatan jiwa atau tumbuh kembang anak. Bila jawaban “ya” ditemukan 2 atau lebih : Rujuk ke rumah sakit yang memiliki fasilitas kesehatan jiwa atau tumbuh kembang anak.Rujukan harus disertai informasi mengenai jumlah dan masalah mental emosional yang ditemukan.
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
96
KUESIONER MASALAH MENTAL EMOSIONAL (KMME) NO PERTANYAAN YA TIDAK
1
Apakah anak anda seringkali terlihat marah tanpa sebab yang jelas? (Seperti banyak menangis, mudah tersinggung atau bereaksi berlebihan terhadap hal-hal yang sudah biasa dihadapinya)
2
Apakah anak anda tampak menghindar dari teman-teman atau anggota keluarganya? (Seperti ingin merasa sendirian, menyendiri atau meras sedih sepanjang waktu, kehilangan minat terhadap hal-hal yang biasa diminati)
3
Apakah anak anda terlihat berprilaku merusak dan menentang terhadap lingkungan di sekitarnya? (Seperti melanggar peraturan yang ada, mencuri, seringkali melakukan perbuatan yang berbahaya bagi dirinya atau menyiksa binatang atau anak-anak lainnya serta tampak tidak peduli dengan nasehat-nasehat yang sudah diberikan kepadanya)
4
Apakah anak anda memperlihatkan adanya perasaan ketakutan atau kecemasan yang berlebihan yang tidak dapat dijelaskan asalnya atau tidak sebanding dengan anak lain seusianya?
5
Apakah anak anda mengalami keterbatasan oleh karena adanya konsentrasi yang buruk atau mudah teralih perhatiannya sehingga mengalami penurunan dalam aktivitas sehari-hari atau prestasi belajarnya?
6
Apakah anak anda menunjukkan perilaku kebingungan sehingga mengalami kesulitan dalam berkomunikasi dan membuat keputusan?
7
Apakah anak anda menunjukkan adanya perubahan pola tidur? (Seperti sulit tidur sepanjang waktu, terjaga sepanjang hari, sering terbangun di waktu tidur malam oleh karena mimpi buruk atau mengigau)
8
Apakah anak anda mengalami perubahan pola makan? (Seperti kehilangan nafsu makan, makan berlebihan atau tidak mau makan sama sekali)
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
97
9
Apakah anak anda seringkali mengeluh sakit kepala, sakit perut atau keluhan-keluhan fisik lainnya?
10
Apakah anak anda seringkali mengeluh putus asa atau berkeinginan untuk mengakhiri hidupnya?
11
Apakah anak anda menunjukkan adanya kemunduran perilaku atau kemampuan yang sudah dimilikinya?
12
Apakah anak anda melakukan perbuatan yang berulang-ulang tanpa alasan yang jelas
b. Deteksi dini gangguan pemusatan perhatian dan hiperaktivitas (GPPH) pada anak prasekolah . GPPH adalah gangguan perilaku yang timbul pada anak dengan pola gejala restlessatautidak bisa diam,inattentiveatau tidak dapat memusatkan perhatian dan perilaku impulsif. Secara umum pola gejala tersebut pada awalnyadikenalsebagaihiperaktivitas padaanak.MenurutDiagnosticand Statistical ManualofMentalDisorder (DSM), definisi GPPH telahmengalami beberapa kali perubahan sesuai denganperubahan konsep tentang penyakit tersebut. SesuaidenganDSMIV,terdapattiga gejalautamayaituinattentivenessatau tidak mampu memusatkan perhatian, hiperaktivitas dan impulsivitas. 1). Tidak Mampu Memusatkan Perhatian (Inattentiveness)
Pemusatan perhatian adalah suatukondisi mental yangberupa kewaspadaan penuh atau alertness, sangat berminat atau arousal,selektivitas,perhatianterus-menerus atausustainedattention,rentang perhatianatauspan ofattention.Anakyangmenderitagangguanini mengalami kesulitan yang besar untuk dapat memiliki daya dan upaya terus menerusatauperhatian terusmenerusdalammenyelesaikan tugas. Kesulitan tersebut kadang-kadang dapat dijumpai pada waktu anak sedang bermain, yaitu perhatian terhadap satu mainan sangat singkatdan sangat mudah beralih dari satu mainanke mainan yang lain. Kondisiini palingseringdilihatpadawaktuanak harusmenyelesaikantugasyang membosankan, kurang menarik, atau
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
98
tugas yang diulang-ulang, seperti menyelesaikan pekerjaan sekolah dan menyelesaikan pekerjaan rumah. Masalah utama yang terjadi pada kondisi ini adalah terjadinya penurunan persistensi upaya atau berkurangnya respons terhadap tugas secara terus-menerus akibat pengaruh dari dalam diri anak itu sendiri, bukan karena pengaruh rangsangan atau sangat sedikit pengaruh dari luar. 2). Hiperaktivitas Gangguan ini memiliki karakteristik utama yaitu aktivitas yang sangat berlebihanatautidaksesuai dengan tingkatperkembangannya,baik aktivitas motorik maupun vokal. Hiperaktivitas paling sering dijumpai sebagai kegelisahan, tidak bisadiam atau restless,tangan dankaki selalu bergerak atau fidgety, tubuh secara menyeluruh bergerak tidak sesuai situasi. Gerakan gerakan tersebut seringkali tanpa tujuan, tidak sesuai dengan tugas yang sedang dikerjakan atau situasi yang ada. Orangtuaataugurusering mengungkapkananakdenganhiperaktivitas sebagai tidak dapat duduk diam, tidak bisa diam, nge-gratak, lasak, banyak bicara, berlari-lari dan memanjat manjat berlebihan, di dalam kelasselaluberjalan-jalan,dan banyakngobroldenganteman,sering menyeletuk. Pada berbagai penelitian ditunjukkan bahwa gerakan pergelangan tangan, pergelangan kakidan gerakan seluruh tubuh lebih banyak dibandingkan dengan yang normal (Barkley dan Ullman, 1975, Barkley dan Cunningham, 1979). Gejala ini sangat berfluktuasiyangmenunjukan adanya kegagalan mengatur tingkat aktivitas sesuai dengan situasi atau tuntutan tugas (Routh, 1978).Gejala hiperaktivitas bukan merupakan gejala yang terpisah dari impulsivitas. Berbagai penelitian terhadap gejala ini dengan pengukuran objektif ataupun skala penilai perilaku, tidak didapatkan buktibahwa hiperaktivitas merupakan faktor atau dimensi yang terpisah dari impulsivitas.
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
99
3). Perilaku Impulsif (Impulsiveness) Anak yang menderita GPPHpada umumnya tidak mampu menghambat tingkah lakunya pada waktumemberikan respons terhadap tuntutan situasional dibandingkan dengan anak normal pada umur dan jenis kelamin sama. Kondisi ini seringkali disebut sebagai impulsivitas. Seperti halnyadengangejalatidak mampumemusatkanperhatian,gejalaini juga merupakan kondisi multi dimensional. Gejala impulsivitas dapat berupa tingkahlakukurang terkendali, tidak mampu menunda respons, tidak mampumenundapemuasan,ataumenghambatprepotent response atau respons yang sangat mendesak (Barkley, 1997). Gambaranklinisanakyangmenderitagangguan iniseringdilaporkan terlalucepatmemberikanrespons, terlalucepatmemberikanjawaban sebelum pertanyaan selesai ditanyakan. Sebagai akibatnya ia sering melakukan kesalahan yang seharusnyatidak perlu terjadi. Anak inijuga tidak mampu mempertimbangkan akibat buruk atau akibat yang merugikan dari keadaan di sekitarnyaatau perilakunya, sehingga ia terlalu sering mengambil risiko yang tidak perlu. Deteksi dini GPPH pada anak dilakukan berdasarkan adanya keluhan dari orang tua atau guru yang dianggap tidak wajar dengan perilaku anak lain pada umumnya, misalnya anak sering tidak bisa duduk tenang, anak selalu bergerak tanpa tujuan dan tidak mengenal lelah, anak sering usil dan sering mengganggu temannya, serta sering terjadi perubahan suasana hati yang mendadak atau impulsif. Berikut ini merupakan langkah-langkah pelaksanaan deteksi dini GPPH pada anak usia dini: a) Tujuan : Deteksi ini dilakukan untuk mengetahui secara dini pada anak adanya GPPH pada anak usia dini (umur 36 bulan ke atas). b) Jadwal Kegiatan: Adapun Jadwal deteksi dini GPPH pada anak dilakukan atas indikasi atau bila ada keluhan dari orang tua atau pengasuh anak
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
100
atau ada kecurigaan tenaga kesehatan, kader kesehatan, BKB, petugas PAUD, pengelola TPA dan guru TK. c) Alat yang digunakan Alat yang digunakan adalah formulir deteksi dini GPPH formulir ini terdiri dari10 pertanyaan yang ditanyakan kepada orang tua atau pengasuh anak atau guru TK dan pertanyaan yang perlu pengamatan pemeriksa. Selain itu terdapat juga alternatif formulir deteksi yang lain yaitu Skala Penilaian Perilaku Anak Hiperaktif Indonesia (SPPAHI) d) Cara menggunakan formulir deteksi dini GPPH: Ajukan pertanyaan dengan lambat, jelas dan nyaring, satu-persatu perilaku yang tertulis pada formulir deteksi dini GPPH. Jelaskan kepada orang tua atau pengasuh anak untuk tidak ragu-ragu atau takut menjawab. Lakukan pengamatan kemampuan anak sesuai dengan pertanyaan pada formulir deteksi dini GPPH. Keadaan yang ditanyakan atau diamati ada pada anak dimanapun anak berada, misal ketika di rumah, sekolah, pasar, toko, dan lain-lain.Setiap saat dan ketika anak denngan siapa saja. Catat jawaban dan hasil pengamatan perilaku anak selama dilakukan pemeriksaan. Teliti kembali apakah semua pertanyaan telah dijawab. e) Interpretasi Beri nilai pada masing-masing jawaban sesuai dengan bobot nilai berikut ini dan jumlahkan nilai masing-masing jawaban menjadi nilai total. Nilai 0 : jika keadaan tersebut tidak ditemukan pada anak Nilai 1: jika keadaan tersebut kadang-kadang ditemukan pada anak Nilai 2 : jika keadaan tersebut sering ditemukan pada anak Nilai 3 : jika keadaan tersebut selalu ada pada anak. Bila nila total 13 atau lebih anak kemungkinan memiliki gejala GPPH
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
101
f) Intervensi anak dengan kemungkinan adanya gejala GPPH perlu dirujuk ke RS yang memiliki fasilitas kesehatan jiwa/tumbuh kembang anak. bila nilai total kurang dari 1 tetapi Anda ragu-ragu jadwalkan pemeriksaan ulang 1 bulan kemudian, ajukan pertanyaan kepada orang-orang terdekat dengan anak.
D. Aktivitas Pembelajaran
Kegiatan 1 : Mengidentifikasi Teknik Deteksi dini tumbuh kembang anak Media : 1. Bahan Tayang 2. LK-1 3. Kertas plano dan perlengkapannya Metode : Diskusi kelompok Langkah-langkah Pembelajaran : 1. Diskusikanlah dengan peserta lainnya tentang teknik apa saja yang dapat digunakan dalam deteksi dini tumbuh kembang anak dengan menjawab pertanyaan berikut:
a. Apa yang dimaksud dengan teknik deteksi dini tumbuh kembang anak!
b. Teknik apa saja yang digunakan dalam deteksi dini tumbuh kembang anak?
c. Siapa pelaksanadanalat apayangdigunakanuntukDeteksiDini tumbuh kembang anak di TK?
2. Tuliskan hasil diskusi dalam LK-1 3. Salah satu anggota kelompok mempresentasikan hasil diskusinya Kegiatan 2 : Menentukan strategi pelaksanaan deteksi dini tumbuh kembang anak Media : 1. Bahan Tayang 2. LK-2 3. Kertas plano dan perlengkapannya Metode : Diskusi kelompok
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
102
Langkah-langkah pembelajaran:
1. Peserta dalam kelompok membaca dengan seksama kasus-kasus pada anak usia dini terkait dengan pertumbuhan dan perkembangannya yang terdapat dalam LK-2
2. peserta berdiskusi dalam kelompoknya untuk menentukan strategi pelaksanaan deteksi dini tumbuh kembang anak
3. peserta berdiskusi dalam kelompok untuk menentukan peralatan/ kuesener yang akan digunakan dalam deteksi dini tumbuh kembang anak
4. peserta mempresentasikan hasil diskusi kelompok kepada kelompok yang lainnya
E. Latihan/Kasus/Tugas
LEMBAR KERJA 3.1 Teknik Deteksi Dini Tumbuh Kembang Anak 1. Tujuan: Setelah peserta mempelajari materi teknik deteksi dini tumbuh kembang anak, peserta diharapkan mampu:
a. Menentukan teknik deteksi dini pertumbuhan dan perkembangan anak usia dini
b. Menjelaskan pelaksana dan alat yang digunakan untuk mendeteksi pertumbuhan dan perkembangan anak usia dini
2. Langkah Kerja:
a. Baca dan pelajari modul tentang teknik deteksi tumbuh kembang anak usia dini
b. Diskusikan bersama dalam kelompok untuk menjawab pertanyaan-pertanyaan yang terdapat di dalam LK 3.1
c. Tuliskanlah hasilnya dalam kolom yang telah disediakan
d. Presentasikanlah hasilnya oleh perwakilan kelompok di depan kelompok yang lainnya
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
103
a. Jelaskan apa yang dimaksud dengan teknik deteksi dini tumbuh kembang anak!
b. Jelaskan apa saja teknik yang digunakan dalam deteksi dini pertumbuhan dan perkembangan anak 3. Siapakah pelaksanadanalat apayangdigunakanuntukDeteksiDini tumbuh kembang anak! Tulis jawabannya pada tabel berikut ini: a. Pelaksana dan alat yang digunakan untuk deteksi dini penyimpangan pertumbuhan
Tingkat Pelayanan
Pelaksana
AlatyangDigunakan
b. Pelaksana dan Alat yang digunakan untuk deteksi dini penyimpangan perkembangan
Tingkat Pelayanan
Pelaksana
AlatyangDigunakan
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
104
LK-3.2 Menentukan strategi pelaksanaan deteksi dini tumbuh kembang anak 1. Tujuan : Setelah peserta mempelajari materi tentang strategi pelaksanaan deteksi dini tumbuh kembang anak, peserta diharapkan mampu:
a. Menyusun langkah-langkah pelaksanaan deteksi dini tumbuh kembang anak
b. Melakukan penanganan terhadap anak yang mengalami permasalahan perkembangan
2. Langkah Kerja: a. Peserta di bagi menjadi 6 kelompok. Masing-masing kelompok terdiri dari 5 orang b. Bacalah contoh kasus berikut ini bersama-sama dalam kelompok, kemudian jawablah pertanyaan-pertanyaan yang mengarahkan anda untuk menentukan strategi pelaksanaan deteksi dini tumbuh kembang terhadap anak yang mengalami permasalahan pada contoh kasus tersebut! c. Buatlah langkah-langkah untuk melaksanakan deteksi dini tumbuh kembang anak terkait kasus 1 dan kasus 2 tersebut d. Bagaimana penanganan atau intervensi yang harus dilakukan dalam menghadapi kasus 1 dan kasus 2 tersebut Kasus 1
Anak usia TKberinisial S,dari hasil pengamatan pendidik adalahanakyangpendiam dansulitbiladiajakbekerjasamadengantemannya dalambermainkelompokatau menyelesaikantugassecarabersama-sama.Reaksi yang munculadalahanakakandiamataucenderunguntuk menarikdiri dari lingkungan sosialnya. Begitupun pada aktivitas di luar kelas, terlihat menyendiridanasyikdenganmainanyangcenderungselaludilakukannyasendiri.
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
105
Kasus 2.
Pada suatu hari di sekolah TK A terjadiperistiwa dimana ada seoranganaktidakmendapatkanmainanyang diinginkannya karena selalu direbutoleh anak yanglain,tiba-tiba anaktersebutmenjeritdan menangistiadahentisambil melemparkan barang-barang yang ada didekatnya, kemudianberguling-guling dilantai.Parapendidik berusaha membujukdan nmenenangkannya,namunperilakumengamuktidakjugamereda tetapi malah semakinmenjadi-jadi. Berdasarkan kasus-kasus tersebut diatas, sebagai seorang pendidik TK :
1. Langkah apa yang harus dilakukan untuk pelaksanaan deteksi dini tumbuh kembang anak terkait dengan kasus tersebut di atas! Instrumen apa yang digunakan dalam melakukan deteksi tersebut!
2. Apa yang harus dilakukan oleh anda sebagai seorang pendidik dalam menangani permasalahan tersebut?
F. Rangkuman
1. Pertumbuhanadalahbertambahnyaukuranfisikdanstrukturtubuh sebagian atau keseluruhan sehingga dapat diukur dengan satuan panjang dan berat,misalnya berat tubuh, tinggi badan/panjang badan, lingkar kepala,pertumbuhan gigi dan pertumbuhan tulang.
2. Perkembanganadalah bertambahnya fungsipsikisdanfisikanak meliputisensorik (mendengar,melihat, meraba,merasa,danmenghirup), motoric(gerakan motorikkasardan halus),kognitif(pengetahuankecerdasan), komunikasi (berbicara dan bahasa), sertasikap religius, sosial-emosionaldan kreativitas..
3. Faktor yang mempengaruhipertumbuhan dan perkembangan pada anak secara umum dibagimenjadi 2, yaitu faktor dalam (internal) dan faktor luar (eksternal/lingkungan). Pertumbuhan dan perkembangan merupakan hasil interaksi dua faktor tersebut.
4. Menurut Permendikbud no. 146 tahun 2014, Deteksidiniadalahkegiatanuntukmenemukan secaradiniadanya potensi
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
106
dan hambatanpertumbuhan danperkembangan pada anak usia dini. Sedangkan Intervensi adalah upaya khusus yang diberikan kepada anak yang menuruthasil deteksi dinidiketahui tumbuh kembangnya tidak optimal. Serangkaian upayakhusus dilakukanuntuk mengoreksi, memperbaiki, danmengatasihambatantumbuhkembangagaranakdapattumbuh dan berkembang secara optimal sesuai dengan potensinya
5. Teknik deteksi yang dilakukan untuk mengetahui kelainan pertumbuhan anak seperti, perawakan yang pendek (short stature), perawakan tinggi (tall stature), yang diklasifikasikan sebagai variasi normal dan patologis, malnutrisi dan dan obesitas, adalah dengan pengukuran antropometri, yang meliputi, berat badan, tinggi badan, dan lingkar kepala
6. Teknik deteksi yang dilakukan untuk mengetahui kelainan perkembangan anak dapat menggunakan perangkat seperti,Kuesioner Pra Skrining Perkembangan (KPSP),Kuesioner Perilaku Anak Prasekolah (KPAP),Tes Daya Lihat (TDL), dan Tes Daya Dengar (TDD)
7. Skrining perkembangan dengan menggunakan kuesioner pra skrining perkembangan (KPSP) Skrining dilakukan oleh tenaga kesehatan, guru TK, petugas PAUD terlatih. Alat yang digunakan adalah formulir KPSP menurut umur. Formulir ini berisi 9-10 pertanyaan tentang kemampuan perkembangan yang telah dicapai anak. Sasaran KPSP anak umur 0- 72 bulan.Alat bantu pemeriksaan berupa: pensil, kertas, bola sebesar bola tenis, kericingan, kubus berukuran 2,5 cm sebanyak 6 buah, kismis, kacang tanah, potongan biskuit kecil berukuran 0,5 - 1 cm
8. GPPH adalah gangguan perilaku yang timbul pada anak dengan pola gejala restlessatautidak bisa diam,inattentiveatau tidak dapat memusatkan perhatian dan perilaku impulsif.
3
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
107
G .Umpan Balik dan Tindak Lanjut
Cocokkanlah jawaban Anda dengan kunci jawaban yang terdapat dibagian akhir modul ini. Hitunglah jawaban yang benar, kemudian gunakan rumus berikut untuk mengetahui tingkat penguasaan Anda terhadap materi ini.
KP
3
PPPPTK TK DAN PLB BANDUNG
© 2016
108
Tingkat penguasaan = Jumlah Jawaban yang benar x 100% Jumlah soal Keterangan: 90 – 100% = Baik sekali 80 – 89 % = Baik 70 – 79 % = Cukup < 70% = kurang Apabila tingkat penguasaan Anda mencapai 80% atau lebih, Anda dapat meneruskan ke materi berikutnya. Jika masih di bawah 80%, Anda harus mengulangi materi ini, terutama bagian yang belum Anda kuasai.
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
109
PPPPTK TK DAN PLB BANDUNG
© 2016
110
KP
4
KEGIATAN PEMBELAJARAN 4
PERMASALAHAN PERKEMBANGAN ANAK USIA DINI DAN PENANGANANNYA
A. Tujuan
Setelah mempelajari materi pokok 4 tentang permasalahan anak usia dini dan penanganannya, anda dapat:
1. Menjelaskan konseppermasalahan anak usia dini
2. Memahami jenis-jenis permasalahan perkembangan anak usia dini
3. Memahami faktor penyebab permasalahan pada anak usia dini
4. Memahami penanganan terhadap permasalahan anak usia dini
B. Indikator Pencapaian Kompetensi
Setelah mempelajari materi pokok 4 tentang permasalahan anak udia dini dan penanganannyadiharapkan Anda dapat:
1. Menjelaskan pengertian permasalahan anak usia dini
2. Mengidentifikasijenis-jenis permasalahan perkembangan
3. Menjelaskan faktor penyebab permasalahan pada anak usia dini
4. Melakukan penanganan terhadap permasalahan anak usia dini
C. Uraian Materi
1. Pengertian Permasalahan pada Anak
Secara harfiah masalah berarti gangguan, dengan demikian permasalahan pada anak dapat diartikan sebagai gangguan pada anak yang timbul karena berbagai faktor. Permasalahan yang umum dan sering terjadi pada anak adalah permasalahan yang berkaitan dengan perkembangan.
2. Jenis-jenis Permasalahan pada Anak
Jenis-jenis permasalahan pada anak digolongkan menjadi tiga yaitu masalah fisik, psikio-sosial, dan masalah belajar. (Saomah : 2004)
a. Permasalahan Fisik
Permasalahan fisik pada anak berkaitan dengan sistem koordinasi dan pancaindra anak. Anak yang mengalami gangguan pada
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
111
pancaindra, sistem koordinasi gerak, atau mengalami hambatan dalam perkembangan fisik motorik dapat dikatakan mengalami masalah secara fisik. Beberapa permasalahan fisik pada anak antara lain masalah motorik, baik motorik kasar maupun motorik halus.
1) Gangguan dalam perkembangan Fisik Anak Usia Dini
Menurut Rusda Koto dan Sri Maryati (1994) dalam perkembangannya mungkin ditemukan beberapa gangguan fisik pada anak diantaranya adalah:
a) Gangguan Fungsi Panca Indra
Gangguan fungsi pada pancaindra yang banyak menimbulkan masalah pada anak adalah gangguan pada indra penglihatan dan pendengaran. Kekurangan daya penglihatan maupun mendengar dapat di ketahui bila derajat penyimpangannya sedah cukup besar dari yang normal.
b) Cacat Tubuh
Cacat tubuh umumnya terdapat pada tangan, kaki atau wajah. Apabila seorang anak mengalami cacat tubuh pada tangan atau kaki maka perkembangannya akan mengalami gangguan karena pada masa usia dini kemampuan tubuh sangat penting untuk menunjang perkembangannya
c) Kegemukan
Kegemukan sering kita temui pada anak usia dini, dan orang tua kadang kala membiarkan atau bahkan senang dengan kegemukan anak karena anak tampak lucu dan menggemaskan.Kegemukan dapat membahayakan kesehatan yang dapat berakibat penyakit jantung, diabetes (kencing manis), dan tekanan darah tinggi. Cara terbaik yang biasa dilakukan ialah dengan mengatur pola makan dan rajin olah raga.
d) Gangguan gerakan peniruan (stereotipik)
Gejala yang tampak dari gangguan stereotipik adalah gerakan motorik kasar (gross motor movement) yang tidak wajar. Gerakan yang disebabkan karena kebiasaan tetapi mempunyai akibat yang tidak baik
PPPPTK TK DAN PLB BANDUNG
© 2016
112
KP
4
e) Malnutrisi (kurang gizi)
Pendapat popular menyatakan bahwa masalah kurang gizi biasa ditemui pada anak-anak di dunia ketiga/negara miskin. Pendapat ini tidak sesungguhnya tepat, karena di negara yang telah majupun masih juga ditemui masalah anak yang kekurangan gizi. Semua ini ternyatalebih kepada pola pengaturan makanan yang sehat dan seimbang. Anak yang mengalami malnutrisi akan tampak pada penampilan fisiknya. Di Indonesia pemerintah telah menggalang program gerakan“4 sehat 5 sempurna”, serta program pemberian makanan tambahan bagi anak di puskesmas, posyandu serta sekolah-sekolah
2) Gangguan dalam Perkembangan Motorik Anak
a) Gangguan dalam Motorik kasar
(1) Ketidak mampuan mengatur keseimbangan. Anak-anak yang mengalami kesulitan dalam mengatur keseimbangan tubuhnya biasanya juga memiliki kesulitan dalam mengontrol gerakan anggota tubuh sehingga terkesan gerakannya ragu-ragu dan tampak canggung.Masalah pengaturan keseimbangan tubuh ini berhubungan dengan sistem vestibular atau sistem yang mengaturkeseimbangan di dalam tubuh.
(2) Reaksi kurang cepat dan koordinasi kurang baik. Salah satu perkembangan motorik pada anak yang perlu diperhatikan adalah kemampuan bereaksi yang semakin cepat, koordinasi mata-tangan yang semakin baik, dan ketangkasan serta kesadaran terhadap tubuh secara keseluruhan. Namun, ada anak yang lambat dalam bereaksi. Koordinasi gerakannya juga tampak kacau sehingga sering kali disebut “ceroboh” dan menjadi bahan ejekan temannya.
b) Gangguan dalam motorik halus
(1) Belum bisa menggambar bentuk bermakna. Kegiatan menggambar merupakan hal yang menyenangkan bagi
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
113
sebagian besar anak. Namun yang perlu diwaspadai adalah jika anak belum dapat menggambar beberapa bentuk yang tergabung dengan baik menjadi satu bentuk yang lebih bermakna. Maka kemampuan anak dalam mempersepsi apa yang ada di sekitarnya perlu dipertanyakan.
(2) Belum bisa mewarnai dengan rapi. Salah satu cara untuk melatih motorik halus anak ialah dengan memberi gambar menarik untuk diwarnai. Biasanya anak akan menyukai kegiatan ini dan bereksperimen dengan menggunakan berbagai macam warna yang disediakan. Hal yang perlu diperhatikan yaitu jika anak enggan untuk mewarnai, cobalah melatih kesabarannya dalam menyelesaikan satu pekerjaan hingga tuntas, sebelum beralih ke pekerjaan lain.
Faktor-faktor yang Mempengaruhi Gangguan Perkembangan Fisik Motorik Perkembangan motorik yang lambat dapat disebabkan oleh beberapa hal,diantaranya adalah:
1. Kelainan tonus otot atau penyakit neuromuskular.Penyakit neuromuscular sepeti muscular distrofi memperlihatkan keterlambatan dalam kemampuan berjalan. Namun, tidak selamanya gangguan perkembangan motorik selalu didasari adanya penyakit tersebut
2. Anak dengan cerebral palsy dapat mengalami keterbatasan perkembangan motorik. Cerebral palsy adalah suatu gangguan atau kelainan yang terjadi pada suatu kurun waktu dalam perkembangan anak, mengenai sel-sel motorik di dalam susunan saraf pusat, bersifat kronik dan tidak maju akibat kelainan atau cacat pada jaringan otak yang belum selesai pertumbuhannya.
3. Kelainan sumsum tulang belakang seperti spina bifida juga dapat menyebabkan gangguan pada perkembangan motorik.
PPPPTK TK DAN PLB BANDUNG
© 2016
114
KP
4
4. Faktor lingkungan serta kepribadian anak juga dapat mengakibatkan gangguan dalam perkembangan motorik anak. Anak yang tidak mempunyai kesempatan untuk belajar seperti sering digendong atau diletakkan di baby walker dapat mengalami hambatan dalam mencapai kemampuan motoric
5. Akibat kelainan bawaan.
Adanya kelainan yang terjadi selama si kecil masih berada di dalam kandungan dapat menyebabkan gangguan pada proses tumbuh kembang fisik motoriknya. Misalnnya karena infeksi TORCH (taksoplasmosis, rubela, cytomegalovirus, dan herpes) serta gangguan plasenta yang mengakibatkan janin tidak dapat berkembang optimal (suplai zat-zat yang dibutuhkan janin tidak terpenuhi).
6. Adanya sejumlah faktor yang mempersulit persalinan, seperti hiperbilirubina (kadar bilirubin di dalam darah melebihi kadar normal) dan hipoksia (kekurangan oksigen) bisa menjadi penyebab terjadinya gangguan perkembangan motorik si bayi di kemudian hari.
Penanganan Gangguan Fisik Motorik pada Anak
a) Deteksi Dini terhadap Gangguan Perkembangan dan Pertumbuhan Anak
1). Pengukuran Berat Badan (BB)
Pengukuran ini dilakukan secara teratur untuk memantau pertumbuhan dan keadaan gizi balita. Balita ditimbang setiap bulan dan dicatat dalam Kartu Menuju Sehat Balita (KMS Balita) sehingga dapat dilihat grafik pertumbuhannya dan dilakukan interfensi jika terjadi penyimpangan.
2). Pengukuran Tinggi badan (TB)
Pengukuran tinggi badan pada anak sampai usia 2 tahun dilakukan dengan berbaring, sedangkan di atas umur 2 tahun dilakukan dengan berdiri. Hasil pengukuran setiap bulan dapat dicatat pada dalam KMS yang mempunyai grafik pertumbuhan tinggi badan
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
115
3). Pengukuran Lingkar Kepala Anak (PLKA)
PLKA adalah cara yang biasa dipakai untuk mengetahui pertumbuhan dan perkembangan otak anak. Biasanya ukuran pertumbuhan tengkorak mengikuti perkembangan otak, sehingga bila ada hambatan pada pertumbuhan tengkorak maka perkembangan otak anak juga terhambat.Pengukuran dilakukan pada diameter occipitofrontal dengan mengambil rerata 3 kali pengukuran sebagai standar
b) Stimulus yang diberikan pada anak untuk perkembangan fisik motorik
Stimulasi Motorik Kasar Tugas perkembangan jasmani berupa koordinasi gerakan tubuh, seperti berlari, berjinjit, melompat, bergantung, melempar dan menangkap,serta menjaga keseimbangan. Kegiatan ini diperlukan dalam meningkatkan keterampilan koordinasi gerakan motorik kasar. Pada anak usia 4 tahun, anak sangat menyenangi kegiatan fisik yang mengandung bahaya, seperti melompat dari tempat tinggi atau bergantung dengan kepala menggelantung ke bawah. Pada usia 5 atau 6 tahun keinginan untuk melakukan kegiatan berbahaya bertambah. Anak pada masa ini menyenangi kegiatan lomba, seperti balapan sepeda, balapan lari atau kegiatan lainnya yang mengandung bahaya. Agar motorik anak dapat berkembang dengan baik dan sempurna perlu dilakukan stimulasi yang terarah dan terpadu. Berikut stimulasi yang dapat diberikan: 1). Jalan
Sebelum orangtua memberikan stimulasi pada anak, pastikan anak sudah melalui perkembangan sebelumnya, seperti duduk, merangkak, dan berdiri. Pada kemampuan motorik kasar ini, yang harus distimulasi adalah kemampuan berdiri, berjalan ke depan, berjalan ke belakang, berjalan berjingkat, melompat/meloncat, berlari, berdiri satu kaki, menendang bola, dan lainnya.Bila perkembangan jalan tidak dikembangkan dengan baik, anak akan mengalami gangguan keseimbangan.
PPPPTK TK DAN PLB BANDUNG
© 2016
116
KP
4
Stimulasi: Orangtua berdiri berjarak dengan anak sambil memegang mainan yang menarik. Gunakan karpet bergambar atau tempelkan gambar-gambar yang menarik di lantai. Minta anak untuk menginjak karpet/lantai. Misalnya, “Ayo Dek, injak gambar gajahnya!” Mainan seperti mobil-mobilan atau troli yang bisa didorong-dorong juga bisa membantu anak belajar berjalan 2). Lari Perkembangan lari akan memengaruhi perkembangan lompat dan lempar serta kemampuan konsentrasi anak kelak, Pada tugas perkembangan ini, dibutuhkan keseimbangan tubuh, kecepatan gerakan kaki, ketepatan 4 pola kaki(heel strike/bertumpu pada tumit, toe off/telapak kaki mengangkat kemudian kaki bertumpu pada ujung-ujung jari kaki, swing/kaki berayun dan landing/setelah mengayun kaki menapak pada alasdan motor planning (perencanaan gerak) Jika perkembangan lari tidak dikembangkan dengan baik, anak akan bermasalah dalam keseimbangannya, seperti mudah capek dalam beraktivitas fisik, sulit berkonsentrasi. Stimulasi: Stimulasi lari bisa dimulai ketika anak berada pada fase jalan, sekitar usia 12 bulan ke atas. Aktivitasnya bisa berupa menendang bola, main sepeda (mulai roda 4 sampai bertahap ke roda 3 dan kemudian roda 2) serta naik turun tangga. 3). Lompat Kemampuan dasar yang harus dimiliki anak adalah keseimbangan yang baik, kemampuan koordinasi motorik dan motor planning (perencanaan gerak). Contoh, saat anak ingin melompati sebuah tali, ia harus sudah punya rencana apakah akan mendarat dengan satu kaki atau dua kaki. Kalaupun satu kaki, kaki mana yang akan digunakan.
Jika anak tidak kuat dalam perkembangan melompat, biasanya akan menghadapi kesulitan dalam sebuah perencanaan tugas
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
117
yang terorganisasi (tugas-tugas yang membutuhkan kemampuan motor planning Stimulasi: Lompat di tempat atau di trampolin. Jangan lompat-lompat di tempat tidur karena meski melatih motorik namun “mengacaukan” kognitif. Dalam arti, mengajarkan perilaku atau mindset yang tidak baik pada anak. Karena seharusnya tempat tidur bukan tempat untuk melompat atau bermain Lompatan berjarak (gambarlah lingkaran-lingkaran dari kapur atau gunakan lingkaran holahop yang diatur sedemikian rupa letaknya). Minta anak untuk melompati lingkaran-lingkaran tersebut, gradasikan tingkat kesulitan dengan memperlebar jarak dan menggunakan kaki dua lalu satu secara bergantian 4) Lempar Pada fase ini yang berperan adalah sensori keseimbangan, rasa sendi (proprioseptif), serta visual. Peran yang paling utama adalah proprioseptif, bagaimana sendi merasakan suatu gerakan atau aktivitas. Misalnya, pada saat anak melempar bola, seberapa kuat atau lemah lemparannya, supaya bola masuk ke dalam keranjang atau sasaran yang dituju. Jika kemampuan melempar tidak dikembangkan dengan baik, anak akan bermasalah dengan aktivitas yang melibatkan gerak ekstrimitas atas (bahu, lengan bawah, tangan dan jari-jari tangan). Seperti, dalam hal menulis. Aktivitas motorik halus lainnya juga terganggu misalnya memakai kancing baju, menalikan sepatu, makan sendiri, meronce, main puzel, menyisir rambut, melempar sasaran, dan lain-lain. Intinya, stimulasi pada perkembangan ini yang tidak optimal berindikasi pada keterampilan motorik halus yang bermasalah Stimulasi:
Main lempar tangkap bola (gradasikan tingkat kesulitannya) yaitu posisi, besar bola, berat bola, dan jenis lambungan. Pada posisi bisa dilakukan sambil duduk kaki lurus, duduk kaki
PPPPTK TK DAN PLB BANDUNG
© 2016
118
KP
4
bersila, duduk kaki seperti huruf W ke belakang, jongkok, dan bahkan berdiri. Pada jenis lambungan, bisa dilakukan dengan lambungan dari atas, sejajar, atau lambungan dari bawah Main dartboard atau lempar panah. Gunakan jenis dartboard yang khusus buat anak-anak (yang aman dan tidak tajam), seperti jenis dartboard yang terbuat dari papan velcrow dan anak panahnya diganti dengan bola yang bervelcrow Stimulasi Motorik Halus Perkembangan motorik halus anak taman kanak-kanak ditekankan pada koordinasi gerakan motorik halus dalam hal ini berkaitan dengan kegiatan meletakkan atau memegang suatu objek dengan menggunakan jari tangan. Pada usia 4 tahun koordinasi gerakan motorik halus anak sangat berkembang bahkan hampir sempurna. Pada usia 5 atau 6 tahun koordinasi gerakan motorik halus berkembang pesat. Pada masa ini anak telah mampu mengkoordinasikan gerakan visual motorik, seperti mengkoordinasikan gerakan mata dengan tangan, lengan, dan tubuh secara bersamaan,antara lain dapat dilihat pada waktu anak menulis atau menggambar. Berikut stimulasi yang dapat diberikan sesuai umurnya. Stimulasi berikut mudah diterapkan dengan sarana dan fasilitas yang ada di sekitar kita: Kelompok umur 1 Tahun ke atas (Balita) Diajarkan untuk menggambar sesuatu, misalnya manusia Diarahkan untuk membuka kancing baju sendiri Bermain menyusun puzzle sederhana Mencuci tangan sendiri Bermain membentuk sesuatu dari plastisin Belajar membaca dan menulis
3) Gangguan Penglihatan
Indra penglihatan berpengaruh besar terhadap perkembangan anak, apabila indra penglihatan mengalami gangguan maka
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
119
perkembangan anak akan terhambat. Melalui indra penglihatan anak dapat membedakan warna dan bentuk yang akan menunjang perkembangan kognitifnya. Permasalahan yang ditimbulkan dari gangguan penglihatan juga menyebabkan gangguan ingatan. Gangguan ingatan tersebut antara lain:
a) Tidak mampu menyebutkan benda tanpa ada bendanya
b) Tidak mampu menguraikan benda-benda yang dilihat daribeberapa aspek, misalnya bentuk, warna, fungsi dan sebagainya.
c) Tidak mampu mencari bagian yang hilang dari suatu bentuk atau gambar.
d) Tidak mampu mengurutkan kembali satu seri gambar yang diacak.
4) Gangguan Pendengaran
Pendengaran merupakan bagian penting yang mempengaruhi perkembangan kognitif, sosial dan emosi anak. Gangguan pendengaran ringan atau sebagian dapat mempengaruhi kemampuan anak untuk berbicara dan memahami bahasa. Masalah pendengaran dapat diatasi jika terdeteksi sejak dini, idealnya pada saat bayi berusia 3 bulan. Oleh karena itu pemeriksaan penyaringan (skrining) dan intervensi dini gangguan pendengaran sangat penting untuk dilakukan. Faktor penyebab gangguan pendengaran pada anak Gangguan pendengaran dapat terjadi jika seorang anak mengalami:
a) Lahir prematur
b) Hiper bilirubinemia (bilirubin tinggi dan memerlukan transfusi darah)
c) Mendapatkan obat-obatan yang dapat menyebabkan gangguan pendengaran
d) Memiliki riwayat gangguan pendengaran di keluarga
e) Ibu mengalami komplikasi pada saat persalinan
PPPPTK TK DAN PLB BANDUNG
© 2016
120
KP
4
f) Infeksi pada telinga (meningitis)
g) Banyak zat lilin di dalam liang telinga (tahi telinga)
h) Benda asing (seperti manik-manik atau ujung cotton bud) yang terjebak di dalam saluran telinga
i) Lendir berlebih di saluran eustachius ( saluran yang menghubungkan telinga dalam dan tenggorokan atas) yang disebabkan oleh pilek
j) Otitis media (infeksi telinga tengah).
Intervensi:
a) Diagnosis masalah pendengaran pada anak
(1) Tes objektif, seperti menguji respon batang otak pendengaran, yang mengukur aktivitas listrik di otak dalam menanggapi suara.
(2) Tes sederhana seperti mendekatkan alat bergetar di dekatnya dan mengamati responnya.
(3) Pengujian dengan audiometer - Mesin yang menghasilkan suara seperti bunyi bip dan peluit. Kemampuan anak dalam mendengar suara tersebut akan menentukan derajat gangguan pendengarannya.
b) Pengobatan gangguan pendengaran pada anak-anak tergantung dari penyebab dan tingkat keparahannya, tetapi biasanya:
(1) Antibiotik untuk otitis media (infeksi telinga tengah)
(2) Mengangkat atau membersihkan benda asing atau zat lilin dari liang telinga
(3) Alat bantu dengar untuk memperkuat suara yang diterima
(4) Implan koklea dapat dipertimbangkan untuk kasus gangguan pendengaran berat atau ketulian total
(5) Vibrotactile aids, yang menerjemahkan suara menjadi getaran yang dirasakan melalui kulit
(6) Terapi wicara
(7) Bantuan dari ahli ketulian untuk membantu anak memaksimalkan kemampuan pendengarannya yang minim.
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
121
5) Gangguan Berbahasa
Bahasa mencakup segala bentuk komunikasi, baik yang diutarakan dalam bentuk lisan, tulisan, bahasa isyarat, bahasa gerak tubuh, ekspresi wajah pantomim atau seni. Perkembangan bahasa tersebut selalu meningkat sesuai dengan meningkatnya usia anak. Orang tua sebaiknya selalu memperhatikan perkembangan tersebut. Sebab pada masa ini, sangat menentukan proses belajar. Hal ini dapat dilakukan dengan memberi contoh yang baik, memberikan motivasi pada anak untuk belajar dan sebagainya. Selain itu, orang tua juga harus mengetahui bagaimana tahapan dalam perkembangan bahasa tersebut. Berbahasa dapat diaplikasikan dalam dua hal, yaitu:
a) Bahasa ekspresif mengacu pada kemampuan individu di dalam menghasilkan suatu bahasa. Misalnya, menyampaikan isi pikiran atau pendapat secara verbal
b) Bahasa reseptif mengacu pada kemampuan individu memahami suatu bahasa. Misalnya, orang yang mengerti bahasa asing tetapi ia tidak dapat berbicara dalam bahasa asing tersebut
Berikut adalah jenis-jenis gangguan yang menghambat perkembangan bahasa anak : a). Disfasia Adalah salah satu bentuk gangguan bahasa yang ditandai dengan kegagalan anak dalam mencapai tahapan perkembangannya sesuai dengan perkembangan bahasa anak normal seusianya.Anak dengan gangguan ini pada usia belum bisa mengucapkan kata spontan yang bermakna, misalnya mama atau papa. Kemampuan bicara reseptif (menangkap pembicaraanorang lain) sudah cukup baik tapi kemampuan bicara eksperatif (menyampaikan suatu maksud) mengalami keterlambatan.
PPPPTK TK DAN PLB BANDUNG
© 2016
122
KP
4
b) Afasia Afasia adalah salah satu jenis kelainan bahasa yang disebabkan adanya kerusakan pada pusat-pusat bahasa di cortex cerebri. Kerusakan pada pusat-pusat yang dialami oleh anak disebut afasia anak. Dan kerusakan pusat yang dialami oleh orang dewasa disebut afasia dewasa. Secara klinis afasia dibedakan menjadi:
(1) Afasia Sensoria
Kelainan ini ditandai dengan kesulitan dalam memberikan makna rangsangan yang diterimanya. Bicara spontan biasanya lancar hanya kadang-kadang kurang relevan dengan situasi pembicaraan atau konteks komunikasi
(2) Afasia Motoris
Kelainan ini ditandai dengan kesulitan dalam mengkoordinasikan atau menyusun pikiran, perasaan dan kemauan menjadi simbol yang bermakna dan dimengerti oleh orang lain. Bicara lisan tidak lancar, terputus-putus dan sering ucapannya tidak dimengerti orang lain. Apabila bertutur kalimatnya pendek-pendek dan monoton. Seorang dengan kelainan ini mengerti dan dapat menginterpretasikan rangsangan yang diterimanya, hanya untuk mengekspresikannya mengalami kesulitan
(3) Afasia Konduktif
Kelainan ini ditandai dengan kesulitan dalam meniru pengulangan bunyi-bunyi bahasa. Pada ucapan kalimat-kalimat pendek cukup lancar, tetapi untuk kalimat panjang mengalami kesulitan
(4) Afasia Amnestik
Kelainan ini ditandai dengan kesulitan dalam memilih dan menggunakan simbol-simbol yang tepat. Umumnya simbol yang dipilih yang berhubungan dengan nama, aktivitas, situasi yang berhubungan dengan aktivitas kehidupan. Misalnya apabila mau mengatakan kursi maka diganti dengan kata duduk
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
123
c). Gagap Gagap adalah gangguan kelancaran atau abnormalitas dalam kecepatan atau irama bicara. Terdapat pengulangan suara, suku kata atau kata atau suatu bloking yang spasmodik, bisa terjadi spasmetonik dari otot-otot bicara seperti lidah, bibir dan laring. Terdapat kecendrungan adanya riwayat gagap dalam keluarga. Selain itu, gagap juga dapat disebabkan oleh tekanan dari orang tua agar anak bicara dengan jelas, gangguan lateralisasi, rasa tidak aman, dan kepribadian anak Faktor yang menyebabkan terjadinya gangguan bahasa dan bicara pada anak, diantaranya: a). Secara biologis, dimana masalah itu berkaitan dengan susunan saraf pusat atau struktur dan fungsi dari sistem lain di dalam tubuh. Misalnya, langit-langit mulut yang tidak sempurna, lidah yang tebal dan pendek b). Lingkungan, dimana anak yang mengalami gangguan ini disebabkan oleh infeksi pada telinga yang berulang yang mengakibatkan terganggu pendengarannya bahkan menjadi tuli. Hal yang lain yang juga berkontribusi adalah penelantaran dan perlakuan yang salah pada anak Intervensi Ada beberapa pendekatan yang dapat dilakukan pada anak dengan gangguan perkembangan bahasa, diantaranya adalah: a) Pendekatan Task Analysis Approach Merupakan suatu pendekatan yang diterapkan dalam upaya penanggulangan kesulitan bahasa. Pendekatan ini bertujuan untuk meningkatkan kemampuan bahasa anak berkesulitan bahasa dengan jalan menganalisis arti kata (semantik), struktur bahasa (sintak dan morphologi) dan fungsi bahasa (pragmatik) secara bertahap dan dalarn tugas yang diuraikan secara rinci.
PPPPTK TK DAN PLB BANDUNG
© 2016
124
KP
4
Sebagai contoh ” makan” untukmenjelaskan makna makan maka pada anak diperlihatkan baik secara kongkrit ataupun melalui media (gambar, rekaman. dll) kegiatan individu yang sedang makan, diperlihatkan proses yang dilakukan dalam kegiatan makan, diperlihatkan perbandingan kegiatan makan dengan kegiatan yang lain seperti kegiatan dalam mencuci piring. Dalam setiap proses yang dilakukan dalam kegiatan tersebut, guru menyebutkan nama kegiatan yang sedang berlangsung dan meminta anak untuk mengulanginya. Kegiatan ini dilakukan secara berkelanjutan sampai anak dapat memahami berbagai konsep yang berkaitan dengan kata “makan” b) Pendekatan Perilaku Untuk mengatasi masalah bahasa yang dialami anak yang berkesulitan bahasa dengan jalan melakukan perubahan perilaku berbahasa dan berkomunikasi yang diperlihatkan anak ataubehavior modification. Dalam prosedur pelaksanaannya, pendekatan ini dilakukan dengan memperhatikan interaksi interpersonal anak dengan teman-teman sebayanya atau orang yang berada di sekitarnya, dan ungkapan-ungkapan verbal yang diperlihatkan oleh anak. Hasil observasi tersebut akan menjelaskan apakah perilaku anak dalam melakukan ungkapan verbal sesuai atau tidak sesuai dengan konteksnya dan temuan ini menjadi dasar untuk program remedial yang ditekankan pada perubahan perilaku yang bertujuan untuk perbaikan atau perubahan perilaku berbahasa dalam berkomunikasi, khususnya dalam bahasa verbal. c) Pendekatan Proses Pendekatan proses adalah suatu pendekatan yang bertujuan untuk memperkuat dan menormalisir proses yang berkaitan dengan proses dasar bahasa yaitu proses penerimaan bahasa dan proses rnengekpresikan bahasa. Dalam pelaksanaannya, pendekatan proses menekankan
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
125
pada intervensi dalam bidang persepsi auditori, ingatan. asosiasi. Interpretasi dan ekspresi verbal. Kegiatan remedial(penanggulangan masalah kesulitan belajar) ditujukan untuk memperkuat pemahaman bahasa dan keterkaitan integratif antara persepsi auditori, ingatan. asosiasi, interpretasi yang sangat diperlukan dalam ekspresi verbal. Kegiatan ini dilakukan secara lisan dan tertulis.
b. Permasalahan Psiko-sosial
Permasalahan psikis berkaitan dengan psikologis anak, sedangkan permasalahan sosial berkaitan dengan kemampuan anak dalam membangun interaksi dengan lingkungannya, terutama teman sebayanya. Ada berbagai permasalahan psiko-sosial yangsering dialami oleh anak usia dini yakni :
1) Agresivitas
Agresivitasadalahistilahumumyang dikaitkandenganadanyaperasaan-perasaanmarahataupermusuhan atautindakanmelukaioranglainbaikdengan tindakankekerasansecarafisik, verbal,maupunmenggunakanekspresiwajahdan gerakan tubuh yang mengancam atau merendahkan.
Bentuk agresivitas anak TK ada beberapa macam. Pertama, bentuk verbal, misalnya dengan mengeluarkan kata-kata“kotor” yang mungkin anak tidakmengertiartinyanamunhanyamenirusaja.Kedua,agresijugabisa dalam bentuktindakanfisik.Misalnyamenggigit,menendang,mencubit.Semuaperilaku ini dimaksudkanuntukmenyakitifisikataubadan. BussdanPerry(1992) menambahkan dua jenis agresi, yakni kemarahan (anger), dan kebencian (hostility). Agresi yang umumnya terjadi pada anak usiaTK adalah hostile aggression yaituagresiyangditujukanke oranglainakibatkesalataumarahpada seseorang.
PPPPTK TK DAN PLB BANDUNG
© 2016
126
KP
4
Agresivitas salahsatu anak TK mungkin menimbulkanperasaantakutpadaanak-anakyanglain. Faktor-faktor PenyebabAgresivitas Berbagaifaktordapatmenjadipenyebabagresivitas,baik factoreksternal maupuninternal.Diantarafaktor internaltersebutadalah faktor biologis.Faktor-faktor biologis (faktor internal) yang mempengaruhi perilaku agresi (Davidoff, 1991) tersebut adalah: a. Gen, merupakan faktor yang tampaknya berpengaruh pada pembentukan sistem neuralotakyangmengatur perilakuagresi.Dari penelitian yang dilakukan terhadap binatang, mulai dari yang sulit sampai yang paling mudah dipancing amarahnya, faktor keturunan tampaknya membuat hewan jantan yang berasal dariberbagai jenislebihmudahmarahdibandingkanbetinanya. b. Sistem otak, yang tidak terlibat dalam agresi ternyata dapat memperkuatataumemperlambatsirkuitneuralyang mengendalikanagresi.Pada hewansecarasederhana,marahdapatdihambatatau ditingkatkandenganmerangsang sistem limbik (daerahyang menimbulkan kenikmatan padamanusia) sehinggamunculhubungan timbal-balik antara kenikmatan dan kekejaman. c. Kimia darah. Kimia darah (khususnyahormon seks yang sebagian ditemukanpadafaktorketurunan)jugadapat mempengaruhi perilakuagresi. Dalam suatueksperimen,seorang ilmuwan menyuntikkan hormontestoteronpadatikus dan beberapahewanlain(testoteron merupakan hormone androgenutamayang memberikancirikelamin jantan) maka tikus-tikus tersebut berkelahi semakin sering dan semakin kuat.Sewaktu testoteron dikurangi, hewantersebut menjadi lembut.
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
127
Adapunfaktoreksternalpenyebab agresivitas adalahlingkungan. Faktor-faktor lingkungantersebutmeliputi: a. Kemiskinan Bila seoranganakdibesarkandalamlingkungankemiskinan,maka perilakuagresi merekasecaraalamimengalamipenguatan (Byod McCendlessdalamDavidoff,1991).Halini dapatdilihatdandialami dalamkehidupansehari-hariapalagidi kota-kotabesar,di perempatan jalan,dalamantrianlampumerah(trafficlight)dimanabiasanya pengendara didatangipengamencilikataupengemis yangjumlahnyalebihdarisatuorangdanberdatangan silihberganti. Bilasalahsatu darimerekadiberiuangmakabersiap-siaplahmenerimaserbuananak lainuntuk meminta jugabagiannya, danakantimbul resiko mereka mencaci makidanbahkanadayangberanimemukul kendaraan jika tidakdiberi uang. c. Suhuudarayangpanas Bila diperhatikan dengan seksamatawuran yang banyak terjadi seringkali terjadi padasianghariditerikpanasmatahari, tetapibila musimhujantidakada peristiwatersebut,begitujugadenganaksi-aksi demonstrasiyang berujungpadabentrokandenganpetugaskeamanan yang biasaterjadipadacuacayangterikdanpanas. d. Meniru(Modelling)
Secaraspesifikselainfactorinternaldaneksternaldi atas,masihada factorlainyangjustrutingkat pemicunya dalambeberapa penelitian dianggap sangat tinggi yaitu adanya peranbelajar model kekerasan melalui suguhan danfasilitas media komunikasi daninformasi yang berkembangdenganbegitupesat.Tidakdapatdipungkiribahwapada saat inianak-anak danremaja banyak belajar menyaksikan
PPPPTK TK DAN PLB BANDUNG
© 2016
128
KP
4
adegan kekerasan melalui televisi dan permainan yang bertema kekerasan. Berikut ini lebih khususdiuraikan secararingkassumber-sumberpermasalahanyangmungkinmemicuagresivitasanak. a.Kemampuan berbicara belum lancar. Sebagaimana orang dewasa, anak memilikikeinginanuntukmengekspresikanpikirandan perasaannyamelaluibahasa.Namunseringkaliitu terhambatoleh keterampilanberbicarayang belumsepenuhnyadikuasai.Kemampuan atau keterampilananak berbicarabelumtercapaidenganbaik, menyebabkananak dalammenyampaikankeinginanatau perasaannya tarhalangolehbahasayangbelumjelas.Disisilainorangtua atau pendidiktidakmemahamiapasesungguhnyayangdiinginkananak. b.Energi anak berlebihan. Energi yangdimiliki anak tidak seimbang dengan aktivitas yang dilakukannya. Apabilaanak lebih banyak dilaranguntukmelakukan aktivitassementara energinyamasihtetapada dananaktidaktahucaramenyalurkannya,akanberakibatia berperilaku yang agresif seperti memukul, menendang, berteriak-teriakataumencarilawanberkelahidanperilakuagresiflainnya.
c.Peniruan.Faktorlingkup social dansituasionalanakadalahstimulus pembentukagresi(Koeswara,1988). Semuaperilakutidakterkecuali agresif merupakan hasil dari proses belajar dari lingkungan baik secara langsung maupun tidaklangsung (Bhawono, 1995). Diantara proses belajar dari lingkungan adalah proses imitasi atau peniruan disebutjugamodelling. Peniruan tidakdilakukan padasemuaorang tetapiterhadapfigur-figurtertentusepertikakak,ayah,ibu atauteman bermain yang memiliki perilaku agresif (Sears dkk, 1991). Selain figur-figurtersebut, televisijugamerupakancontohyang dapat
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
129
mengajarkanperilakuagresifdari tayangan-tayanganagresifyang disajikan(Seifer,2003).Misalnyatayanganfilm kekerasan,kriminal (Gelfand, 1975). Dari film-film dan tayangan lainnya yang mengandung unsur agresifitas, anak akan cenderung meniru model yang disaksikannyaditelevisidanmenjadipemicumeningkatnya perilakuagresif(ErondanHuesmanndalamChen,1994). d.Merasa Terluka. Perasaan anak yang terluka entah karena kesal, marah, kecewa, sedih dan ia tidak tahu bagaimana carayang semestinyauntukmengungkapkanperasaan-perasaanitu, makaia melampiaskannyadenganperilakuyangagresif. e.Mencari Perhatian. Anak yang kurang mendapatkan perhatian dari orang-orang disekelilingnya akan terus mencari perhatian. Kadang anak yang diberi sebutan “nakal” langsung mendapat perlakuan khususbaikoleh pendidikmaupunorangtuanyasedemikianrupa. Sementara anakyangberbuat baikjustrutidakmendapat perhatian. Maka iaakan menjadi anak yangnakal alias berbuat agresif untuk memperoleh perhatian dari orang tuanya atau pendidiknya seperti anaklainnya,sekalipunperhatianitu berwujudmarahdannasehat panjanglebar. Intervensi
a. Mengajarkanpada semua anak tentangketerampilan sosial untuk berhubungandenganoranglain.
b. Menciptakan lingkungan sekolah yang menekan tingkat frustrasi atau tekanan pada anak, pemaksaan, situasi dimana anak harusmenunggu,diamatauributlebihdari2menit.
c. Menggunakan program kegiatan belajar dengan metode mendongeng,roleplay,dansosiodramayang menggunakanboneka untukmengajaritentangpemecahanmasalahtanpa kekerasanfisik atauemosional.
PPPPTK TK DAN PLB BANDUNG
© 2016
130
KP
4
d. Memberikan kesempatan yang banyak bagianak-anak untuk mengekspresikankeinginandan kekuatannyadengancara-cara tertentu, misalnya dengan memberikan pilihan-pilihan kegiatanyang dapatmengurangifrustrasiyang dapatmendorongagresivitas anak.
e. Bagianak-anak yangterusmemukul atauagresiftekankan bahwa hal tersebutsangatmenggangguatau menyakitianaklain,gunakan kalimatseperti, “kamuharusmemberitahuyang lainapabilakamu menginginkan sesuatu.Jikateman-temanmu tidakmau mendengarkan,makamintalahbantuankepadaguru.“
f. Bilaperilaku agresif anak berkurang, segera diberi umpan balik berupapujianataudengankata-katayangmendorongia akanterus mengurangi perbuatan agresifnya. Nyatakan dengan perasaan senangdanbanggaakanperbuatannya.
g. Bagi anak yang cenderung menjadikorbandari anak-anak yang agresif, maka ajarkanlah keterampilan yang dibutuhkanuntukmembeladiri, misalnyadenganmenghindardari anak-anakyang berperilaku agresif atau meminta bantuan kepada pendidik bila merasadirinyatakutatauterancam.
2). Temper Tantrum Temper tantrum merupakan luapan emosi yang meledak-ledak dan tidak terkontrol. Kejadian ini seringkali muncul pada anak usia 15 bulan sampai 6 tahun. Salah satu penyebabnya adalah anak tidak mampu mengungkapkan perasaannya dengan kata-kata ataupun ekspresi yang diinginkannya, sehingga anak mengalami frustasi atas keadaannya. (Hasan, Maimunah : 2009). Suatukewajaran apabilaanakusia4tahunmudahmeledak atau “ngambek”,sebabiasudahmampumengekspresikankemarahan,kekecewaan atau kecemasannya. Tetapiperilakusepertiitutidakbolehdibiarkanberlanjuthingga usiadewasanya,sebabperilakutersebutdapatmenetapdanmenjadisenjatabagi anakuntukditurutiataudipenuhikeinginan-keinginannya.
kencingdicelana.
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
131
Faktor PenyebabTemperTantrum TemperTantrumini bisaterjadidisebabkankarenaanakbelummampu mengontrolemosinyadanmengungkapkanamarahnyasecaratepat.Beberapaahli menyebutkanpenyebabtemper tantrum yang palingumum terjadipadaanakkarenabeberapahal,yaitu:
a) Kelelahan. Aktivitas motorikanakseringkalikurangdisadarisebagai pemicu timbulnya temper tantrum. Dalam keadaan lelah, seringkali anakmerespon segala sesuatu dengan menolak, sehingga menyebabkan kejengkelan orangdisekitarnya.
b) Frustrasi. Karena adanya keinginannya yang tidak terpenuhiatau usahanyayangdirasatidakpernahberhasilbaik.
c) Lapar.Perutyangkosongseringmemicurasaemosiyangtinggipada anak. Lambung yang kosong seringkali menyebabkan anak cepat merasamualdantidakenakbadan.
d) Sakit. Seperti halnya lapar, rasa sakit padaanak seringkali menyebabkan anak mengamuk karena ia sendiri juga terkadang bingungdenganapayangdirasakannya.PadausiaTK initidaksemua anakbisamengungkapkanapayangia rasakan,anakhanyamerasakan bahwaiamerasatidakenakuntukberaktivitas,sehinggaresponyang adaseringkalitidaktepat.
e) Kemarahan. Kemarahanyangmenyebabkan anakngamukinidapat terjadi karena beberapa hal,misalnya tidakterpenuhi keinginannya, mainannyadiambil,atausikapyangmemaksanyamelakukansesuatu
f) Kecemburuan. Salahsatucirikhassifatyangmenonjol padaanak usia TK adalah keinginannya untuk sama dengan teman-temannya yang lain, terutama dalam hal kebendaan, misalnya mainan, tas,sepatu, ataupun baju.Rasacemburu atauiriinilahyang terkadang muncul dalam mendorong anak untuk memaksa meminta sesuatu
PPPPTK TK DAN PLB BANDUNG
© 2016
132
KP
4
kepadaorangtuaatauorangdewasadisekitarnya tanpabisamelihat kondisiataukeadaanyangada.
g) Perubahan dalam rutinitas. Adanya perbedaanaturan ataupun kegiatanyang dilakukanseringkalianakmerasatidakmenyukai perubahan tersebut. Misalnya, pola asuh yang diterapkan dirumah serbamembolehkannya melakukan segalasesuatudankeinginannya selalu terpenuhi, namun di situasi disekolah sangatlah berbeda.
h) Tekanandirumahdandisekolah. Saatinianakmulaiinginmenunjukkanbahwaia bisa melakukan beberapa hal sesukanya, namun seringkali hal ini terhambatkarenaketidakpahamanorang disekitarnya.Keinginan orangtua atau pendidik seringkali bertentangan dengan potensi dan minatanak.
Intervensi Dalam menghadapi permasalahan perilaku inihalyangpalingpenting yang harusadapadapendidikadalahsikapyang tenang,lemahlembut,dan tidak terpancing untuk ikut marah. Beberapa hal yang berkenaan dengan intervensi adalah:
a) Intervensisecaraumum
(1) Pencegahandenganmengenalikebiasaan-kebiasaan anak,mengetahui secarapastipadakondisi-kondisisepertiapa munculnyatantrumserta mengatur pola asuh dan pola didik yang baik bagi orangtua dan pendidik.
(2) Ketikatantrumterjadimaka hendaknyamemastikansegalanyaaman, orangtuaataupendidikharustetaptenangdan
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
133
berusahamenjaga emosinyasendiriagartetap tenang,tidak mengacuhkantantrum,jika perilakutantrumdarimenitkemenitsemakinbertambah burukdan tidakselesai-selesaimakapelukanakdenganrasacinta.
(3) Ketikatantrumtelah berlalumakajangandiikutidenganhukuman, nasehat-nasehat,atau teguranmaupunsindiran-sindiran;jangan memberikan hadiah apapun, berikanlah rasa cintadan aman pada anak;orangtuabekerjasamadenganpendidikperlumengevaluasi.
2) Gangguan Pemusatan Perhatian dan Hiperaktif (GPPH)
Gangguan Pemusatan Perhatian danHiperaktivitas (GPPH)adalah suatu kondisi medis yang ditandai oleh ketidakmampuan memusatkan perhatian, hiperaktif dan atau impulsif yang terdapat lebih sering dan lebih berat dibandingkandengananak-anakyang sebaya.Masalahiniterdapatsecara menetap (persisten) dan biasanyamenyebabkan kesulitan dalam kehidupan anak, baik di rumah, sekolah, atau dalam hubungan sosial antar manusia. a). Hiperaktif Hiperaktivitas merupakan aktivitas motorik yang tinggi dengan ciri-ciri aktivitas selalu berganti, tidak mempunyai tujuan tertentu, berulang dan tidak bermanfaat (Hallahan & kaufman, 1994). Anak hiperaktif lebih banyak mengalamigerakanmatadiluartugasnya,sehinggagerakanmenolehlebihbanyakdibandingkan anak yang lain. Gejala tersebut akan berkurang sesuai denganbertambahnyausiadansebagianakanmenghilangpadawaktumasaremaja. Berikut ini faktor-faktor yang menyebabkan hiperaktif pada anak:
(1) Faktor neurologik
PPPPTK TK DAN PLB BANDUNG
© 2016
134
KP
4
Perilakuhiperaktifyanglebihtinggididapatkan padabayiyanglahir denganmasalah-masalahprenatalsepertilamanyaproses persalinan, persalinandenganmenggunakanalat bantu, dibandingkandengan kehamilandanpersalinannormal.Di sampingitufaktor-faktorseperti bayiyanglahirdenganberatbadanrendah,ibuyang terlalumuda,ibu yangmerokokdanminumalkohol. Terjadinya perkembangan otak yang lambat. Faktor etiologi dalam bidangneuoralogi yangsampaikinibanyakdianutadalahterjadinya disfungsi minimal otak(DMO)danminimalnya dopamin. Dopaminmerupakan zat aktif yang berguna untuk memelihara proses konsentrasi. Beberapa studi menunjukkan terjadinya gangguan fungsi darah di daerahtertentupadaanakhiperaktif, yaitudidaerahstriatum,daerah orbital-prefrontal, daerah orbital-limbik otak, khususnya sisi otak sebelahkanan
(2) Faktor toksik
Beberapa zatmakanansepertisalisilatdanbahan-bahan pengawet memiliki potensi untuk membentuk perilaku hiperaktif pada anak. Di sampingitu,kadartimah dalamserumdarahanakyangmeningkat, ibu yang merokokdanmengkonsumsialkohol,terkenasinarrontgen padasaat hamiljugadapatmelahirkancalonanakhiperaktif.
(3) Faktor genetik
Didapatkanhubunganyang tinggidarihiperaktifyang terjadipada keluargadengananakhiperaktif.Kuranglebihsekitar25-35%dariorangtuadansaudarayangmasakecilnyahiperaktif akanmenurunpadaanak. Halinijugaterlihatpadaanakkembar.
(4) Faktor psikososial dan lingkungan
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
135
Pada anak hiperaktif sering ditemukan hubungan yang dianggap keliruantaraorangtua dengananaknya,misalnyaanakkurangdiarahkan. Kurangmengontroldiri, menurutkehendaksendiri,seringgagaldalam pekerjaan,materiyang disampaikankurangmenarik,diterangkantidak mengerti,inginbebas,kurangperhatian,anakkurangdiarahkandi rumah, kelainansyaraf,fisik,perlukonsultasi Intervensi
a) Hiperaktivitas sebagian besardisebabkan olehgangguanfisik,maka dalam sekolah diharuskan punyakelaskhusus,karenamemerlukan penanganan yangmultidisipliner yaitupendidik, orangtua,danahli sepertidokterataupsikologanak.
b) Tetapi bila ada anak yangmengalami hiperaktivitas, pihak sekolah menyediakan neurolog, psikolog anak, dokter anak pembimbing khusus bagi anak yang hiperaktif. Pendidik bersikap sabar dan programkegiatanyangdilaksanakanharusbersifatkhusus.
c) Pada saat pelaksanaan proses belajar, pendidik hendaknya menggunakan teknik penguatan, yaitumenghargai setiap usaha dan keberhasilan yang dicapai olehanak. Pendidik harus menciptakansituasidan kondisiyangmenyebabkananakmerasaberhasil,misalnya memberikan tugas-tugas yang mungkin dapat diselesaikan anak denganmudah.Dengancara demikiananakakanmerasasenang mengerjakan tugassehingga anaktidakcepatmengalihkan kegiatan dengankegiatanyanglain.
b). Sulit konsentrasi/gangguan pemusatan perhatian (GPP)
Gangguansulitberkonsentrasiatau gangguanpemusatanperhatian(GPP) adalahsuatugangguanpadaotakyangmengakibatkan
PPPPTK TK DAN PLB BANDUNG
© 2016
136
KP
4
kesulitankonsentrasidan pemusatanperhatian.Delapanpuluhpersenanak yang mengalami GPP memperlihatkankesulitanbelajardankelainanperilaku. PenyebabSulitBerkonsentrasi Permasalahangangguanataupemusatanperhatianyang jugabiasadikenal dengankonsentrasi,diperkirakanberasaldari berbagaifaktor,antara lain:
(1) Faktorgenetikterutamapadaanaklaki-laki
(2) Gangguanpadamasaprenatal ataupadamasadidalamkandungan danpadamasaperinatalataupadasaatproseskelahiran
(3) Ibuhamilyangkecanduanalkohol
(4) Akibattraumakepala,misalnyakarenaprosespersalinanyang menggunakanalatbantu,ataubenturankerasdikepalanya
(5) Keracunantimbal,zatpewarnadosistinggidalammakanan
(6) TekananPsiko sosial sepertitidakmendapatperhatiandankasih sayang dariorangtuanya,sehinggakebutuhandasaranaktidak terpenuhi.
Intervensi Halyangperludiingatdalammemberikanintervensianakyangmemilikikonsentrasi yang rendah haruslah sabar dan jangan memaksa karena anakcenderung memberontak.
a) Mencermatiaktivitasataukegiatanyangdisukainya,dengancirianakakan memiliki perhatian yang lebih pada aktivitas tersebutdibandingkan dengan yang lain. Misalnya, anak suka sekalimemperhatikangambar-gambarhewan. Halinidapatdijadikandasar pendekatankepadaanakmelaluihalyangdisukainya.
b) Mengajarkandanmenguatkanperhatianyangterfokusdanmendetail.Anak dibimbing bersama untuk memperhatikan sesuatu dengan
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
137
seksama.Misalnyadenganmemperhatikanstimulusyang berupa gambar-gambar untukmencaripersamaaandanperbedaan.
c) Dalam menata ruangan kelas, haruslah rapi sehingga anak tidak cepat beralih perhatiannya
d) Memberi pujian atau ganjaran kepada anak, bila anak dapat berhasil menyelesaikan tugas dengan baik. Perlu diperhatikan bahwatugasyangdiberikanjanganterlalusulitatauterlalumudahdalamprosesmenyelesaikantugas.
c). Permasalahan Belajar Permasalahan belajar yang diungkapkan oleh saomah (2004) berkaitan dengan kesulitan belajar. Disini penulis mengungkapkan bahwa permasalahan belajar bukan hanya mengenai kesulitan belajar atau ketidakmampuan anak dalam mencapai atau mengikuti taraf belajar yang telah ditentukan tetapi juga mengenai giftedness (keberbakatan). Kesulitan belajar adalah suatu gangguan dalam satu atau lebih proses psikologis dasar dan penggunaan bahasa ujaran atau tulisan. Gangguan tersebut berupa kesulitan mendengarkan, berpikir, berbicara, membaca, menulis, mengeja atau berhitung Kesulitan belajar dapat digolongkan menjadi disleksia, diskalkulia, dan disgrafia. Ketiganya merupakan permasalahan pada kesulitan belajar, sedangkan giftedness adalah keadaan pada anak yang memiliki IQ diatas rata-rata. Permasalahan anak berbakat ini apabila diatasi sejak dini akan menguntungkan semua pihak, karena anak gifted merupakan anak yang memiliki kecerdasan luar biasa. 1). Disleksia
Gejaladarikesulitanmembacainiadalahkemampuanmembacaanakberadadibawahkemampuan yangseharusnyadenganmempertimbangkantingkatinteligensi,usiadanpendidikannya.Gangguan
PPPPTK TK DAN PLB BANDUNG
© 2016
138
KP
4
inibukanbentukdariketidakmampuanfisik,sepertikarenaadamasalahdenganpenglihatan,tapi mengarahpadabagaimanaotakmengolahdanmemprosesinformasiyangsedangdibacaanaktersebut.Kesulitaninibiasanyabaruterdeteksisetelahanakmemasukiduniasekolahuntuk beberapawaktu. Gejala-gejalayangtampak:
a) Tidakdapatmengucapkaniramakata-katasecarabenardanproporsional.
b) Kesulitandalammengurutkanhuruf-hurufdalamkata.
c) Sulitmenyuarakanfonem(satuanbunyi)danmemadukannyamenjadisebuahkata.
d) Sulitmengejasecarabenar.Bahkanmungkinanakakanmengejasatukatadenganbermacam ucapan.
e) Sulitmengejakataatausukukatadenganbenar.Anakbingungmenghadapihurufyangmempunyaikemiripanbentuksepertib–d,u–n,m–n.
f) Membacasatukatadenganbenardisatuhalaman,tapisalahdihalamanlainnya.
g) Kesulitandalammemahamiapayangdibaca.
h) Seringterbalikdalammenuliskanataumengucapkankata.Misal,„hal‟menjadi„lah‟,atau„kucing dudukdiataskursi‟menjadi„kursidudukdiataskucing‟
i) Rancudengankata-katayangsingkat,misalnyake,dari,dan,jadi.
j) Bingungmenentukantanganmanayangdipakaiuntukmenulis.
k) Lupamencantumkanhurufbesarataumencantumkannyaditempatyangsalah.
l) Lupameletakkantitikdantanda-tandabacalainnya.
m) Menulishurufdanangkadenganhasilyangkurangbaik.
n) Terdapatjarakpadahuruf-hurufdalamrangkaiankata.Tulisannyatidakstabil,kadangnaik, kadangturun.
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
139
o) Menempatkan paragraph secarakeliru.
Faktorpenyebabdaridisleksiaadalah :
a) Faktorketurunan
Disleksiacenderungterdapatpadakeluargayangmempunyaianggotakidal.Namun,orangtua yangdisleksiatidaksecaraotomatismenurunkangangguaninipadaanak-anaknya,atauanakkidal pastidisleksia.
b) Problem pendengaran sejak usia dini
Jikakesulitanpendengaranterjadisejakdinidantidakterdeteksi,makaotakyangsedang berkembang akansulitmenghubungkanbunyiatausuarayangdidengarnyadenganhurufataukata yangdilihatnya.Padahal,perkembangankemampuanmendengarsangatpentingbagiperkembangan kemampuanbahasayangakhirnyadapatmenyebabkankesulitanjangkapanjang.Konsultasidan penanganandaridokterahliamatdiperlukan.
c) Faktor kombinasi.
Yaknikombinasidariduahaldiatas.Faktorkombinasiinimenyebabkananakyangdisleksiamenjadi kianseriusatauparah,hinggaperlupenangananmenyeluruhdankontinyu. 2). Disgrafia Kelainansarafinimenghambatkemampuanmenulisyangmeliputihambatanfisik,sepertitidak dapatmemegangpensildenganmantapataupuntulisantangannyaburuk.Anakdengangangguan disgrafiasebetulnyamengalamikesulitandalammengharmonisasikaningatandenganpenguasaan gerakototnyasecaraotomatissaatmenulishurufdanangka.
Kesulitaninisangatmenghambatdalamprosesbelajar,terutamaanakyangberadaditingkatSD. Merekajugaseringdianggapbodoholehorangtuadanguru.A
PPPPTK TK DAN PLB BANDUNG
© 2016
140
KP
4
kibatnyamerekamengalamifrustrasi karenasebenarnyamerekainginmengekspresikanpikirandanpengetahuanyangdidapatnyadalam bentuktulisan,tapimerekamengalamihambatan. Gejala-gejalayangtampak:
a) Adaketidakkonsistenanbentukhurufdalamtulisannya.
b) Saatmenulis,penggunaanhurufbesardanhurufkecilmasihtercampur.
c) Ukurandanbentukhurufdalamtulisannyatidakproporsional.
d) Anaktampakberusahakerassaatmengkomunikasikanide,pengatahuandanperasaannyadalam bentuktulisan.
e) Sulit memegang alat tulis dengan mantap, seringkali terlalu dekat bahkan hampir menempel dengan kertas
f) Berbicara pada diri sendiri ketika menulis atau terlalu memperhatikan tangan yang dipakai untuk menulis
g) Cara menulis tidak konsisten
h) Tetap mengalami kesulitan meskipun hanya diminta menyalincontohtulisanyangsudahada.
Intervensi Orangtuadangurubisamembantuanakdengangangguandisleksiadenganbeberapahal, diantaranya:
a) Pahamikeadaananak
Sebaiknyatidakmembandingkananaktersebutdengananak-anaklain.Sikapsepertiituakan membuatorangtua/gurudananakmerasastres.Jikamungkin,berikantugasmenulisyangsingkat- singkatsaja.Ataumemintakebijakandarisekolahuntukmemberikantessecaralisan.
b) Menulisdenganmemakaimedialain.
Berikesempatanuntukmenulisdenganmenggunakan computer ataumesinketik.Dengan menggunakan computer
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
141
anakbisamengetahuikesalahannyadalammengejadenganmenggunakan fasilitaskorektorejaan.
c) Membangunrasapercayadirianak.
Berikanpujianyangwajarbagianakatasusahanya.Hindariuntukmenyepelekanatau melecehkannyakarenahalituakanmembuatnyarendahdiridanfrustrasi.Kesabaranorangtua/guruakanmembuatanaktenangdansabarterhadapdirinyadanusahayangdilakukannya.
d) Latihanakuntukterusmenulis.
Pilihstrategiyangsesuaidengantingkatkesulitannyauntukmengerjakantugasmenulis.Berikan tugasyangmenarikdanmemangdiminatinya.Bisajugamemintanyauntukmemebuatgambaruntuk tiap paragraph dalamtulisannya. 3). Diskalkulia Yaknigangguanpadakemampuankalkulasisecaramatematis.Terbagimenjadibentukkesulitan berhitung(counting)dankesulitankalkulasi(calculating).Anaktersebutakanmenunjukkankesulitan dalammemahamiproses-prosesmatematis.Biasanyaditandaidengankesulitanbelajardan mengerjakantugasyangmelibatkanangkaatau simbol matematis. Gejala-gejalayangTampak:
a) Tingkatperkembanganbahasadanlainnyanormal.Seringkalimempunyaimemorivisualyangbaik dalammerekamkata-katatertulis.
b) Sulitmelakukanhitunganmatematis.Termasukmisalnya,sulitmenghitunguangkembalian,atau
PPPPTK TK DAN PLB BANDUNG
© 2016
142
KP
4
c) transaksi.Anakmenjaditakutmemeganguang,ataumenghindaritransaksi.
d) Sulitmelakukanproses-prosesmatematis,sepertimenjumlah,mengurang,membagi,dansulitmemahamikonsephitunganangkaatauurutan.
e) Kadangmengalamidisorientasiwaktuatauarah.
f) Terhambatdalammenggunakankonsepabstraktentangwaktu.Misalnyaiabingungdalam mengurutkejadianmasalaluataumasamendatang.
g) Mengalamihambatandalampelajaranmusik,karenasulitmemahaminotasi,urutannadadan sebagainya.
h) Bisamengalamikesulitandalamaktivitasolahragakarenabingungmengikutiaturanmainyang berhubungandengan system skor.
Faktor-faktoryangmenyebabkangangguanbelajariniadalah:
a) Kelemahanpadaprosespenglihatanatauvisual.
b) Kesulitandalamprosesmengurutinformasi.
Matematikasangatmembutuhkanprosedurpenyelesaianyangberurutdanmengikutipola-pola tertentu,sehinggabilaadakesulitandalammengurutinformasi,danhalinisangatberkaitandengan prosesmengingat,makaanakakankesulitanuntukmengikutidanmengikutiproseduruntuk menyelesaikanpersoalanmatematis.
c) Fobiamatematika.
Adanyakeyakinandalamdirianakyangbersangkutanbahwadiatidakbisamatematikaakan membuatdiapunyasikapyang negative tentangmatematika.Fobiainimungkinakibatdaritrauma denganpelajaranmatematika,sehinggadiakehilanganke
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
143
percayaandirinyaterhadaphal-halyang berhubungandenganmatematika. Intervensi Untukmembantuanakdengandiskalkuliabelajar,orangtua/pendidik bisa:
a) Usahakanuntukmenggunakangambar,kata-kataataugrafikuntukmembantupemahaman.
b) Hubungkankonsep-konsepmatematikadalamaktivitassehari-harianak.
c) Lakukanpendekatanyangmenarikterhadapmatematika,misalnyapermainanmatematikadalam komputerataubuku-buku.Dalampermainanitu adakonsep-konsepuntukmemahamiproses-proses matematis,sepertimejumlahataumengali.Danluangkanwaktuuntukberlatihtiaphari.
d) Tuliskankonsepmatematisatauangka-angkadiataskertasagaranakmelihatnyadantidak sekedarabstrak.
e) Doronganakuntukmelatihingatansecarakreatif,misalnyamenyanyikanangka-angkaatau caralainuntukmempermudahpenampilaningatannyaakanangka.
f) Pujisecarawajaruntukkeberhasilandanusahaanak.
g) Lakukanprosesasosiasiuntukkonsepyangsedangdipelajarinyadengankehidupansehari-hari.
D. Aktivitas Pembelajaran
Kegiatan 1 :Berfikir reflektif tentang permasalahan perkembangan anak usia dini Media : 1. Bahan tayang 2. LK-1 3. Kertas Plano, spidol dan glu-tek Metode : Diskusi kelompok, window shopping
PPPPTK TK DAN PLB BANDUNG
© 2016
144
KP
4
Langkah-langkah pembelajaran:
1. Buatlah kelompok sebanyak 5 kelompok untuk berdiskusi menjawab
pertanyaan-pertanyaan berikut:
a. Apa yang dimaksud dengan permasalahan perkembangan anak usiadini?
b. Tuliskan permasalahan perkembangan yang sering terjadi pada anak di sekolah!
c. Jelaskan faktor-faktor yang menyebabkan terjadinya permasalahan perkembangan pada anak tersebut!
2. Tuliskan hasil diskusi pada LK 1 dan pindahkan ke dalam kertas plano
3. Setiap kelompok menempelkan kertas plano di dinding ruangan, kemudian salah seorang anggota menjaga kertas plano tersebut untuk melayani peserta dari kelompok lain yang ingin melihat hasil kerja kelompoknya melalui window shopping
4. Semua peserta berkunjung ke setiap kelompok secara bergiliran untuk mengomentari hasil diskusi kelompok lain.
5. Pelatih memberikan penguatan
Kegiatan 2 : Identifikasi permasalahan perkembangan anak usia dini Media : 1. Bahan Tayang 2. LK-2 3. Kertas plano dan perlengkapannya Metode : Diskusi kelompok Langkah-langkah Pembelajaran :
1. Diskusikanlah dengan peserta lainnya bagaimana peran pendidik dalam mengidentifikasi permasalahan perkembangan pada anak usia dini
2. Jelaskan tentang jenis permasalahan perkembangan pada anak usia dini berikut ini (definisi dan gejala yang tampak)
a. Gangguan perkembangan fisik motorik
b. Gangguan perkembangan bahasa
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
145
c. Gangguan perkembangan psiko sosial: Agresivitas, GPPH, dan kesulitan belajar (disgrafia, disleksia, diskalkulia)
3. Jelaskan bagaimana intervensi/penanganan terhadap ketiga jenis gangguan perkembangan anak tersebut
4. Tuliskan hasil diskusi dalam LK-2
5. Salah satu anggota kelompok mempresentasikan hasil diskusinya
E. Latihan/Kasus/Tugas
LEMBAR KERJA 4.1 Berpikir Reflektif Permasalahan Perkembangan Anak Usia Dini 1. Tujuan : Setelah mengikuti pembelajaran tentang permasalahan perkembangan anak usia dini, peserta diharapkan mampu:
a. Menjelaskan tentang permasalahan perkembangan anak usia dini
b. Menjelaskan tentang faktor-faktor yang menyebabkan permasalahan perkembangan tersebut
2. Langkah Kerja: Diskusikan bersama dalam kelompok untuk menjawab pertanyaan-pertanyaan yang terdapat di dalam LK-1 a. Jelaskan apa yang dimaksud dengan permasalahan perkembangan anak usia dini
b. Jelaskan permasalahan perkembangan anak apa saja yang sering terjadi di lingkungan sekolah anda
PPPPTK TK DAN PLB BANDUNG
© 2016
146
KP
4
c. Apa faktor-faktor yang menyebabkan terjadinya permasalahan perkembangan tersebut
LEMBAR KERJA 4.2 Mengidentifikasi permasalahan perkembangan anak usia dini 1. Tujuan: Setelah peserta mempelajari permasalahan perkembangan anak usia dini, peserta diharapkan mampu:
a. Mengidentifikasi jenis-jenis permasalahan perkembangan anak usia dini di lingkungan sekolahnya
b. Melakukan penanganan/intervensi terhadap permasalahan perkembangan anak usia dini di lingkungngan sekolahnya
2. Langkah kerja:
a. Lakukanlah identifikasi permasalahan perkembangan anak usia dini di lingkungan sekolah TK yang saudara bimbing
b. Diskusikan bersama dalam kelompok bagaimana peran pendidik dalam mengatasi permasalahan di sekolah tersebut
c. Coba jelaskan jenis-jenis gangguan atau permasalahan perkembangan fisik motorik, perkembangan bahasa dan psiko-sosial. Bagaimana penanganan terhadap gangguan atau permasalahan tersebut
d. Tuliskan hasil diskusinya dalam kolom berikut ini:
Jenis-jenis permasalahan perkembangan anak usia dini di lingkungan sekolah
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
147
Gangguan Perkembangan Fisik motorik dan penanganannya (minimal 2 jenis)
Gangguan perkembangan bahasa dan penanganannya! (minimal 2 jenis)
Gangguan perkembangan psiko-sosial dan penanganannya! (minimal 2 jenis)
F. Rangkuman
1. Secara harfiah masalah berarti gangguan, dengan demikian permasalahan pada anak dapat diartikan sebagai gangguan pada anak yang timbul karena berbagai faktor. Permasalahan yang umum dan sering terjadi pada anak adalah permasalahan yang berkaitan dengan perkembangannya.
2. Ada dua faktor yang mempengaruhi permasalahan pada anak yakni faktor internal dan faktor eksternal. Faktor internal yaitu faktor-faktor yang berasal dari dalam diri inidivu atau anak sedangkan faktor eksternal adalah faktor-faktor dari luar seperti lingkungan tempat anak berada.
3. Jenis-jenis permasalahan pada anak digolongkan menjadi tiga 3 (menurut Saomah, 2004) yaitu fisik, psiko-sosial dan masalah belajar. Permasalahan fisik pada anak berkaitan dengan sistem koordinasi dan panca indra anak.
PPPPTK TK DAN PLB BANDUNG
© 2016
148
KP
4
4. Gangguan dalam perkembangan fisik pada anak usia dini meliputi, gangguan fungsi panca indra, cacat tubuh, kegemukan, gangguan gerakan meniru (stereotipik) dan malnutrisi (kurang gizi).
5. Gangguan dalam perkembangan motorik anak dibagi menjadi gangguan motorik kasar dan motorik halus. Gangguan dalam motorik kasar meliputi: gangguan keseimbangan tubuh, reaksi kurang cepat dan koordinasi kurang baik. Sedangkan gangguan dalam motorik halus meliputi: anak belum bisa menggambar bentuk bermakna dan anak belum bisa mewarnai dengan rapi.
6. Penanganan terhadap gangguan penanganan fisik motorik dapat dilakukan dengan deteksi dini gangguan perkembangan dan pertumbuhan anak seperti, pengukuran berat badan, tinggi badan, dan lingkar kepala anak, serta tes Denver. Selain itu anak juga diberikan stimulasi agar perkembangan fisik motoriknya lebih baik.
7. Indra penglihatan berpengaruh besar terhadap perkembangan anak, apabila indra penglihatan mengalami gangguan maka perkembangan anak akan terhambat. Melalui indra penglihatan anak dapat membedakan warna dan bentuk yang akan menunjang perkembangan kognitifnya.
8. Pendengaran merupakan bagian penting yang mempengaruhi perkembangan kognitif, sosial dan emosi anak. Gangguan pendengaran ringan atau sebagian dapat mempengaruhi kemampuan anak untuk berbicara dan memahami bahasa.
9. Jenis-jenis gangguan yang menghambat perkembangan bahasa anak, diantaranya Disfasia, Afasia, gagap.
10. Jenis-jenis gangguan psiko-sosial diantaranya meliputi agresivitas, cemas, temper tantrum, gangguan pemusatan perhatian, dan hiperaktif.
11. Jenis gangguan kesulitan belajar terdiri atas, disleksia, disgrafia dan diskalkulia.
G. Umpan Balik dan Tindak Lanjut
Cocokkanlah jawaban Anda dengan kunci jawaban yang terdapat dibagian akhir modul ini. Hitunglah jawaban yang benar, kemudian gunakan rumus berikut untuk mengetahui tingkat penguasaan Anda terhadap materi ini.
Tingkat penguasaan = Jumlah Jawaban yang benar x 100%
3
KP
4
PPPPTK TK DAN PLB BANDUNG
© 2016
149
Jumlah soal Keterangan: 90 – 100% = Baik sekali 80 – 89 % = Baik 70 – 79 % = Cukup < 70% = kurang Apabila tingkat penguasaan Anda mencapai 80% atau lebih, Anda dapat meneruskan ke materi berikutnya. Jika masih di bawah 80%, Anda harus mengulangi materi ini, terutama bagian yang belum Anda kuasai.
PPPPTK TK DAN PLB BANDUNG
© 2016
150
PPPPTK TK DAN PLB BANDUNG
© 2016
151
3
KUNCI JAWABAN
Kegiatan Pembelajaran 1
1. A
2. A
3. A
4. B
5. C
Kegiatan Pembelajaran 2
1. B
2. A
3. B
4. D
5. A
PPPPTK TK DAN PLB BANDUNG
© 2016
152
EVALUASI
Jawablah pertanyaan di bawah ini dengan memberikan tanda silang (x) pada pilihan jawaban yang menurut Anda paling benar! 1. Menurut Permendikbud No. 146 tahun 2014, yang dimaksud dengan pertumbuhan adalah...
A. Bertambahnya ukuran fisik dan struktur tubuh sehingga dapat diukur dengan satuan panjang dan berat
B. Bertambahnya ukuran fisik dan bersifat kualitatif
C. Betambahnya fungsi psikis dan fisik anak
D. Bertambahnya kemampuan struktur dan fungsi tubuh yang lebih kompleks
2. Berikut ini merupakan faktor internal yang mempengaruhi pertumbuhan dan perkembangan, kecuali........
A. Keluarga
B. Jenis Kelamin
C. Kelainan genetik
D. Gizi
3. Upaya penjaringan yang dilaksanakan secara komprehensif untuk menemukan penyimpangan tumbuh kembang pada anak usia dini disebut......
A. Intervensi
B. Deteksi dini
C. Stimulasi
D. Interaksi
4. Deteksi dini untuk mengetahui kelainan pertumbuhan pada anak dapat menggunakan teknik antropometri, yang meliputi pengukuran.....
A. Berat badan, tinggi badan, gangguan motorik kasar
B. Tinggi badan, lingkar kepala anak, gangguan psikologis
C. Berat badan, tinggi badan, lingkar kepala anak
D. Berat badan, tinggi badan, gangguan wicara
3
PPPPTK TK DAN PLB BANDUNG
© 2016
153
5. Berikut ini merupakan pelaksana deteksi dini penyimpangan pertumbuhan di tingkat keluarga dan masyarakat, kecuali....
A. Orang tua
B. Kader kesehatan
C. Guru PAUD/TK
D. Ahli Gizi
6. Deteksi dini perkembangan anak dapat dilakukan melalui skrining perkembangan, yang terdiri atas beberapa perangkat, kecuali....
A. Tabel berat badan/tinggi badan
B. Kuesener pra skrining perkembangan (KPSP)
C. Kuesener perilaku anak pra sekolah (KPAP)
D. Tes daya Lihat (TDL)
7. Denver Development Screening Test II (DDST) dapat digunakan untuk mendeteksi masalah perkembangan anak terutama dalam hal....
A. Diagnosis kesulitan belajar
B. Diagnosis gangguan bahasa
C. Diagnosis gangguan emosional
D. Membandingkan kemampuan perkembangan anak yang seumur
8. Berikut ini merupakan cara menggunakan kuesener pra skrining perkembangan (KPSP), kecuali.....
A. Menentukan anak
B. Memilih KPSP yang sesuai dengan usia anak
C. Menjawab pertanyaan dalam KPSP oleh orang tua
D. Menjawab pertanyaan dalam KPSP oleh guru TK
9. Manakah pernyataan yang benar berikut ini yang merupakan interpretasi hasil KPSP.....
A. Jumlah jawaban “ya” = 7 atau 8, perkembangan anak sesuai tahap perkembangannya (S)
B. Jumlah jawaban “ya” = 6 atau kurang, perkembangan anak meragukan (M)
PPPPTK TK DAN PLB BANDUNG
© 2016
154
C. Jumlah jawaban “ya” = 9 atau 10, perkembangan anak sesuai tahap perkembangannya (S)
D. Jumlah jawaban “ya” = 5 atau kurang, kemungkinan ada penyimpangan (P)
10. Jadwal untuk pelaksanaan deteksi untuk Tes Daya Dengar (TDD) adalah...
A. Setiap 2 bulan pada anak usia 12 bulan ke atas
B. Setiap 3 bulan pada anak usia 12 bulan ke atas
C. Setiap 4 bulan pada anak usia 12 bulan ke atas
D. Setiap 6 bulan pada anak usia 12 bulan ke atas
11. Berikut ini merupakan faktor-faktor yang mempengaruhi gangguan perkembangan fisik motorik, kecuali...
A. Neuromuscular
B. Cerebral Palsy
C. Infeksi TORCH
D. Disleksia
12. Salah satu bentuk stimulasi yang diberikan agar kemampuan berjalan anak dapat berkembang dengan baik adalah...
A. Bermain dengan menggunakan mainan mobil-mobilan yang bisa di dorong
B. Bermain menendang bola
C. Melompat di tempat atau trampolin
D. bermain lempar tangkap bola
13. Gangguan perkembangan bahasa dimana anak pada usia seharusnya belum bisa mengucapkan kata spontan yang bermakna seperti “mama” atau “papa” di sebut...
A. Afasia
B. Disfasia
C. Disgrafia
D. Diskalkulia
3
PPPPTK TK DAN PLB BANDUNG
© 2016
155
14. Gangguan perkembangan bahasa yang disebabkan oleh adanya kerusakan pada pusat-pusat bahasa di cortex cerebri disebut...
A. Afasia
B. Disfasia
C. Disgrafia
D. Diskalkulia
15. Penanganan terhadap anak yang mengalami gangguan bahasa melalui pendekatan yang menekankan pada intervensi dalam bidang persepsi auditori, ingatan, asosiasi, adalah.....
A. Pendekatan proses
B. Pendekatan perilaku
C. Pendekatan Task Analysis Approach
D. Pendekatan Interpersonal Interaktif
16. Salah satu permasalahan Psiko-sosial pada anak, dimana anak suka melakukan tindakan kekerasan baik fisik maupun verbal kepada guru atau temannya adalah...
A. Kecemasan
B. Agresivitas
C. Ketakutan
D. Hiperaktif
17. Berikut ini merupakan faktor-faktor eksternal yang menyebabkan perilaku agresif pada anak, kecuali....
A. Kemiskinan
B. Suhu udara yang panas
C. Meniru (Modelling)
D. Orang tua yang terlalu melindungi
18. Salah satu faktor yang menyebabkan sifat pemalu pada anak adalah....
A. Anak selalu ditinggal sendirian di rumah
B. orang tua terlalu menetapkan aturan yang berlebihan
C. Anak terlalu banyak menerima hukuman karena dianggap salah
D. Anak kurang bersosialisasi di lingkungannya
PPPPTK TK DAN PLB BANDUNG
© 2016
156
19. Salah satu bentuk intervensi yang dapat dilakukan terhadap anak yang pemalu adalah....
A. Pendidik hendaknya selalu memberikan dorongan dan pujian pada anak
B. Pendidik mengajarkan tentang kemandirian
C. Memelihara kenyamanan dan keamanan
D. Mengajarkan sifat kesadaran
20. Aktivitas motorik yang tinggi pada anak dengan ciri-ciri aktivitas selalu berganti, tidak mempunyai tujuan tertentu, berulang dan tidak bermanfaat, disebut...
A. Agresivitas
B. Hiperaktif
C. Impulsif
D. Temper tantrum
3
PPPPTK TK DAN PLB BANDUNG
© 2016
157
PENUTUP
Modul yang mengkaji tentang Deteksi tumbuh kembang anak usia dini merupakan modul diklat Guru Pembelajar bagi guru TK level 1 sebagai bagian yang tidak terpisahkan dari sepuluh level modul lainnya dalam Diklat Pengembangan Keprofesian Berkelanjutan bagi Guru Taman Kanak-kanak. Perluasan wawasan dan pengetahuan peserta berkenaan dengan substansi materi ini penting dilakukan, baik melalui kajian buku, jurnal, maupun penerbitan lain yang relevan. Disamping itu, penggunaan sarana perpustakaan, media internet, serta sumber belajar lainnya merupakan wahana yang efektif bagi upaya perluasan tersebut. Demikian pula dengan berbagai kasus yang muncul dalam penyelenggaraan pendidikan taman kanak-kanak, baik berdasarkan hasil pengamatan maupun dialog dengan praktisi pendidikan taman kanak-kanak, akan semakin memperkaya wawasan dan pengetahuan para peserta diklat. Dalam tataran praktis, mengimplementasikan berbagai pengetahuan dan keterampilan yang diperoleh setelah mempelajari modul ini, penting dan mendesak untuk dilakukan. Melalui langkah ini, kebermaknaan materi yang dipelajari akan sangat dirasakan oleh peserta diklat. Disamping itu, tahapan penguasaan kompetensi peserta diklat sebagai guru kelas taman kanak-kanak, secara bertahap dapat diperoleh. Pada akhirnya, keberhasilan peserta dalam mempelajari modul ini tergantung pada tinggi rendahnya motivasi dan komitmen peserta dalam mempelajari dan mempraktekan materi yang disajikan. Modul ini hanyalah merupakan salah satu bentuk stimulasi bagi peserta untuk mempelajari lebih lanjut substansi materi yang disajikan serta penguasaan kompetensi lainnya.
PPPPTK TK DAN PLB BANDUNG
© 2016
158
DAFTAR PUSTAKA
Agus Mulyadi. 2012. Tumbuh Kembang Anak Usia Dini. Bandung: PPPPTK TK dan PLB Bandung
Buku Ajar Anak Usia Dini. Diunduh pada tanggal 26 November 2015 dari http://staff.uny.ac.id/sites/default/files/lain-lain/dr-rita-eka-izzaty-spsi-msi/buku%20ajar-final.pdf Dokter Kecil. 2011. Pentingnya GIZI untuk KECERDASAN Anak. Diakses pada 20 Februari 2012 dari http://dokterkecil. wordpress.com/tag/gizi/ Departemen Kesehatan RI.(1995).Pedoman Deteksi Dini Tumbuh Kembang Balita, Jakarta. Djauhar Ismail. (1996).Tatalaksana Penyimpangan Tumbuh Kembang Balita di Tingkat Pelayanan Dasar. Disampaikan pada Lokakarya Deteksi Dini Tumbuh Kembang di Bandung, 25 Maret - 27 Maret 1996. Eman Suparman. 2012. Perkembangan Koginitf. Bandung: PPPPTK TK dan PLB Bandung Essa, L. E. 2003. Introduction to Early Childhood Education, Fourth Edition, Canada: Thomson, Delmar Learning.
Gangguan Perkembangan Motorik Pada Anak. Diunduh pada tanggal 24 November 2015, dari http://lia2112.blogspot.co.id/2015/03/gangguan-perkembangan-motorik-pada-anak.html.
Gangguan Perkembangan Sosial emosional pada Anak Usia dini. Diunduh pada tanggal 24 Oktober 2015, dari https://primazip.wordpress.com/2013/06/08/gangguan-perkembangan-sosial-dan-emosional-anak-usia-dini/ Hurlock, B. Elizabeth. 1997. Psikologi Perkembangan 5ed. Jakarta: Erlangga Heru Santoso Wahito Nugroho. (2009). Petunjuk praktis Denver Developmental Screening Test. Cetakan I. Jakarta: Buku Kedokteran EGC
3
PPPPTK TK DAN PLB BANDUNG
© 2016
159
H. Martinis yamin & Jamilah Sabri Sanan. (2010). Panduan Pendidikan Anak Usia Dini PAUD. Jakarta: Gaung Persada press James Le Fanu (alih bahasa Irham Ali Saifudin). (2010). Atasi dan Deteksi Ragam Masalah Kejiwaan Anak Sejak Dini. Cetakan I. Yogyakarta: Garailmu Kasina Ahmad dan Hikmah. 2005. Perlindungan dan Pengasuhan Anak Usia Dini. Jakarta: Ditjen Dikti Depdiknas Moersintowarni, B. Narendra. (2005). Pengukuran Antropometri pada Penyimpangan Tumbuh Kembang Anak (Anthropometric.measurement Of DeviationIn Child Growth AndDevelopment).Surabaya: Divisi Tumbuh Kembang Anak dan Remaja,.FK Unair / RSU Dr. Soetomo.
Perkembangan Bahasa pada Anak Usia Dini. Diunduh pada tanggal 10 Desember 2015, dari http://www.kompasiana.com/miftahulmip/bagaimanakah-perkembangan-bahasa-pada-anak-usia-dini-aud_54f79ecba33311641e8b45ef Rahmat Hidayat. 2012. Perkembangan Fisik Motorik. Bandung: PPPPTK TK dan PLB Bandung Santrock J. W. 2009.Psikologi Pendidikan. Jakarta: Salemba Humaniora Soetjiningsih. (1998).Tumbuh Kembang Anak. Jakarta: EGC Soetjiningsih. (2003). Perkembangan Anak dan Permasalahannya. Jakarta: EGC. Subbagian Pediatri Sosialtumbuh Kembang.(2004).Pemantauan Perkembangan DENVER II. Yogyakarta: Bagian IKA/INSKAFak. Kedokteran UGM / RS. Dr.Sardijito Subbagian Tumbuh Kembang. (2004).PemantauanPerkembangan Denver II. Yogyakarta: Bagian Ilmu Kesehatan Anak FKUGM/RS Sardjito. Suyitno, H, dan Narendra, M. B. (2003). Pertumbuhan Fisik Anak. Jakarta:EGC.
Strategi Layanan Anak Gangguan Perkembangan Bahasa. Diunduh pada tanggal 24 November 2015, dari
PPPPTK TK DAN PLB BANDUNG
© 2016
160
http://vhasande.blogspot.co.id/2013/09/strategi-layanan-anak-gangguan.html Tanuwijaya, S. (2003). Konsep Umum Tumbuh dan Kembang. Jakarta: EGC Tim Dirjen Pembinaan Kesmas. (1997). Pedoman Deteksi Dini Tumbuh Kembang Balita. Jakarta: Departemen Kesehatan RI. Wolfolk,A. 2009. Educational Psychology.Yogyakarta:Pustaka Pelajar Yaya, K. 2012. Perkembangan Nilai-nilai Agama dan Moral Anak Taman Kanak-kanak. Bandung: PPPPTK TK dan PLB Bandung Yusuf, S. 2007. Psikologi Perkembangan Anak dan Remaja. Bandung: Rosda Karya Yusuf, S. (2001).Psikologi Perkembangan Anak dan Remaja. Bandung: Rosdakarya. Yuliani Nurani Sujono.(2007). Buku Ajar Konsep Dasar Pendidikan Anak Usia Dini. Jakarta: UNJ.
3
PPPPTK TK DAN PLB BANDUNG
© 2016
161
GLOSARIUM
1. Pertumbuhan adalah bertambahnya ukuran fisik dan struktur tubuh sebagian atau keseluruhan sehingga dapat diukur dengan satuan panjang dan berat, misalnya berat tubuh, tinggi badan/panjang badan, lingkar kepala, pertumbuhan gigi dan pertumbuhan tulang.
2. Perkembangan adalah bertambahnya fungsi psikis dan fisik anak meliputi sensorik (mendengar, melihat, meraba, merasa, dan menghidu), motoric (gerakan motoric kasar dan halus), kognitif (pengetahuan, kecerdasan), komunikasi (berbicara dan bahasa), serta sikap religius, sosial-emosional dan kreativitas.
3. Deteksi dini merupakan upaya penjaringan yang dilaksanakan secara komprehensif untuk menemukan penyimpangan tumbuh kembang dan mengetahui serta mengenal faktor resiko (fisik, biomedik, psikososial)
4. Intervensi adalah suatu kegiatan penanganan segera terhadap adanya penyimpangan tumbuh kembang dengan cara yang sesuai dengan keadaan misalnya perbaikan gizi, stimulasi perkembangan atau merujuk ke pelayanan kesehatan yang sesuai
5. Pengukuran Antropometri adalah teknik pengukuran yang dilakukan untuk mengetahui kelainan pertumbuhan anak seperti, perawakan yang pendek (short stature), perawakan tinggi (tall stature), yang diklasifikasikan sebagai variasi normal dan patologis, malnutrisi dan dan obesitas
6. Pengukuran Berat Badan (BB) adalah pengukuran yang dilakukan secara teratur untuk memantau pertumbuhan dan keadaan gizi balita. Balita ditimbang setiap bulan dan dicatat dalam Kartu Menuju Sehat
7. Pengukuran Tinggi Badan (TB) adalah pengukuran tinggi badan pada anak sampai usia 2 tahun dilakukan dengan berbaring, sedangkan diatas umur 2 tahun dilakukan dengan berdiri.
8. Pengukuran Lingkar Kepala Anak (PLKA) adalahpengukuran untuk mengetahui pertumbuhan dan perkembangan otak anak.
9. Kuesioner Pra Skrining Perkembangan (KPSP) adalah suatu daftar pertanyaan singkat yang ditujukan kepada orang tua dan dipergunakan
PPPPTK TK DAN PLB BANDUNG
© 2016
162
sebagai alat untuk melakukan skrining pendahuluan perkembangan anak usia 3 bulan sampai dengan 6 tahun.
10. Kuesioner Perilaku Anak Prasekolah (KPAP)adalah sekumpulan kondisi-kondisi perilaku yang digunakan sebagai alat untuk mendeteksi secara dini kelainan-kelainan perilaku anak prasekolah, sehingga dapat segera dilakukan tindakan untuk mengantisipasinya.
11. Tes Daya Dengar (TDD) adalah tes yang dilakukan untuk menemukan gangguan pendengaran sejak dini, agar dapat segera ditindaklanjuti untuk meningkatkan kemampuan daya dengar dan bicara anak.
12. Anamnesis adalah wawancara yang dilakukan oleh dokter dengan orang tua anak untuk mengumpulkan informasi mengenai data anak dan riwayat kesehatannya (http://kamuskesehatan.com/arti/ataksia/)
13. Tes Daya Lihat (TDL) adalah tes yang dilakukan untuk mendeteksi secara dini adanya kelainan penglihatan pada anakagar segera dapat dilakukan tindakan intervensi sehingga kesempatan untuk memperoleh ketajaman penglihatan menjadi lebih besar.
14. Disfasia adalah salah satu bentuk gangguan bahasa yang ditandai dengan kegagalan anak dalam mencapai tahapan perkembangannya sesuai dengan perkembangan bahasa anak normal seusianya
15. Afasia adalah salah satu jenis kelainan bahasa yang disebabkan adanya kerusakan pada pusat-pusat bahasa di cortex cerebri. Kerusakan pada pusat-pusat yang dialami oleh anak disebut afasia anak
16. Gagap adalah gangguan kelancaran atau abnormalitas dalam kecepatan atau irama bicara. Terdapat pengulangan suara, suku kata atau kata atau suatu bloking yang spasmodik, bisa terjadi spasme tonik dari otot-otot bicara seperti lidah, bibir dan laring
17. Agresivitas adalah istilah umum yang dikaitkan dengan adanya perasaan- perasaan marah atau permusuhan atau tindakan melukai orang lain baik dengan tindakan kekerasan secara fisik, verbal, maupun menggunakan ekspresi wajah dan gerakan tubuh yang mengancam atau merendahkan

Tidak ada komentar: